Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Economic Development Packet 2023 01-03-23
AGENDA ECONOMIC DEVELOPMENT COMMITTEE MEETING Tuesday, January 3, 2023 6:00 p.m. City Hall Conference Room 800 Game Farm Road, Yorkville, IL Citizen Comments: Minutes for Correction/Approval: December 6, 2022 New Business: 1. EDC 2023-01 Building Permit Report for November 2022 2. EDC 2023-02 Building Inspection Report for November 2022 3. EDC 2023-03 Property Maintenance Report for November 2022 4. EDC 2023-04 Economic Development Report for December 2022 5. EDC 2023-05 New Leaf Solar Energy – Annexation, Rezoning and Special Use Old Business: Additional Business: United City of Yorkville 800 Game Farm Road Yorkville, Illinois 60560 Telephone: 630-553-4350 www.yorkville.il.us UNITED CITY OF YORKVILLE WORKSHEET ECONOMIC DEVELOPMENT COMMITTEE Tuesday, January 3, 2023 6:00 PM CITY HALL CONFERENCE ROOM --------------------------------------------------------------------------------------------------------------------------------------- CITIZEN COMMENTS: --------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------- MINUTES FOR CORRECTION/APPROVAL: --------------------------------------------------------------------------------------------------------------------------------------- 1. December 6, 2022 □ Approved __________ □ As presented □ With corrections --------------------------------------------------------------------------------------------------------------------------------------- NEW BUSINESS: --------------------------------------------------------------------------------------------------------------------------------------- 1. EDC 2023-01 Building Permit Report for November 2022 □ Informational Item □ Notes ___________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________ --------------------------------------------------------------------------------------------------------------------------------------- 2. EDC 2023-02 Building Inspection Report for November 2022 □ Informational Item □ Notes ___________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________ --------------------------------------------------------------------------------------------------------------------------------------- 3. EDC 2023-03 Property Maintenance Report for November 2022 □ Informational Item □ Notes ___________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________ --------------------------------------------------------------------------------------------------------------------------------------- 4. EDC 2023-04 Economic Development Report for December 2022 □ Informational Item □ Notes ___________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________ --------------------------------------------------------------------------------------------------------------------------------------- 5. EDC 2023-05 New Leaf Solar Energy – Annexation, Rezoning and Special Use □ Moved forward to CC __________ □ Approved by Committee __________ □ Bring back to Committee __________ □ Informational Item □ Notes ___________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________ -------------------------------------------------------------------------------------------------------------------------------------- ADDITIONAL BUSINESS: --------------------------------------------------------------------------------------------------------------------------------------- Have a question or comment about this agenda item? Call us Monday-Friday, 8:00am to 4:30pm at 630-553-4350, email us at agendas@yorkville.il.us, post at www.facebook.com/CityofYorkville, tweet us at @CityofYorkville, and/or contact any of your elected officials at http://www.yorkville.il.us/320/City-Council Agenda Item Summary Memo Title: Meeting and Date: Synopsis: Council Action Previously Taken: Date of Action: Action Taken: Item Number: Type of Vote Required: Council Action Requested: Submitted by: Agenda Item Notes: Reviewed By: Legal Finance Engineer City Administrator Community Development Purchasing Police Public Works Parks and Recreation Agenda Item Number Minutes Tracking Number Minutes of the Economic Development Committee – December 6, 2022 Economic Development Committee – January 3, 2023 Majority Committee Approval Minute Taker Name Department DRAFT Page 1 of 3 UNITED CITY OF YORKVILLE ECONOMIC DEVELOPMENT COMMITTEE Tuesday, December 6, 2022, 6:00pm City Council Chambers 800 Game Farm Rd., Yorkville, IL Note: In accordance with Public Act 101-0640 and Gubernatorial Disaster Proclamation issued by Governor Pritzker pursuant to the powers vested in the Governor under the Illinois Emergency Management Agency Act, remote attendance was allowed for this meeting to encourage social distancing due to the ongoing Covid-19 pandemic. In Attendance: Committee Members Vice-Chairman Ken Koch/in-person Alderman Chris Funkhouser/in-person Alderman Joe Plocher/in-person Other City Officials City Administrator Bart Olson/in-person Assistant City Administrator Erin Willrett/in-person Community Development Director Krysti Barksdale-Noble/in-person Senior Planner Jason Engberg/in-person Code Official Pete Ratos/in-person Other Guests Jake Victor, Northpointe Development/in-person Molly Krempski/in-person Mike Krempski/in-person Dave Guss/in-person Tom Bowman, Bowman Subdivision/electronic attendance The meeting was called to order at 6:00pm by Vice-Chairman Ken Koch. Citizen Comments None Minutes for Correction/Approval October 4, 2022 The minutes were approved as presented. New Business 1. EDC 2022-68 Building Permit Reports for September and October 2022 Mr. Ratos reported 126 building permits issued in September and 142 in October. He gave a breakdown of the types of structures that will be built. Page 2 of 3 2. EDC 2022-69 Building Inspection Reports for September and October 2022 There were 767 inspections in September and 754 in October. Mr. Ratos said some of the inspections are still being outsourced. 3. EDC 2022-70 Property Maintenance Reports for September and October 2022 In September there were 26 cases and 3 of those were heard. In October there were 15 cases and all violations were remediated. 4. EDC 2022-71 Economic Development Reports for October and November 2022 Mr. Olson gave the report and said Station One Smokehouse is progressing in Kendall Crossing. It is the last developable lot in that area. Craft'd will open soon and there are many other projects as outlined in the report from Lynn Dubajic Kellogg. It was noted that the Morris Hospital facility is leaving the city. 5. EDC 2022-72 Bowman Subdivision – Final Plat Mr. Engberg said this is the Final Plat for the subdivision located at the SW corner of Van Emmon and Timber Oak Lane (street formerly named Benjamin). The petitioner wishes to subdivide the land into 2 separate parcels and a right-of-way needs to be dedicated to the city. Committee members also briefly discussed the easements for stormwater and ComEd. This moves to PZC next week and to City Council in January. 6. EDC 2022-73 Northpointe Development – Rezoning and Variance Mr. Jake Victor, Vice-President of Development with Northpointe Development, was present to explain their proposed senior living project at the SE corner of Sycamore Rd. and Rt. 34. It is a 3-story, 45 unit condo complex. It is currently zoned B-3 and the developer will ask for R-4. The maximum number of dwelling units for R-4 is 8 per acre and they wish to increase that 13 units. Mr. Engberg said that during a recent “lifecycle” meeting, city residents requested more senior living availability. Mr. Victor said his company has been doing these projects in the Chicago area for 10 years. He said this is affordable housing and the site was chosen based on the many services available in the area. He explained the many details and amenities of the housing itself and he said current Yorkville residents would be prioritized for rental options. He said there will be a virtual neighborhood meeting with Fox Hill residents next week. Notices have been sent to the residents and another mailing will be done to including a greater area of Fox Hill. Alderman Koch asked for an update of feedback from that meeting. Rentals will be for households earning between $25,000 to $80,000 and it will be age- restricted. Mr. Victor will be applying for tax credits from the state and if he does not receive them, the project cannot go forward. He will receive notice of the tax credits by June. Alderman Funkhouser requested a data sheet of all this information. Alderman Koch stated, and others agreed, they would not be in favor of any zoning change until the tax credits are determined. Page 3 of 3 Ms. Noble said a Plan Council meeting was held which included traffic information. Additional information will be placed on the city website and the project will come back in the summer for a Public Hearing. Old Business: 1. EDC 2021-44 Lisa Pickering Loop – Proposed Virtual Bike Path & Monument Mr. Engberg gave an update on the feasibility of a monument at Rt. 47 and Somonauk to honor former City Clerk Pickering. IDOT said it would need to be as far from the road as possible and be a breakaway type. Staff is asking for input on this, but a memorial will still be erected in Beecher Park. The committee asked staff to pursue the SW corner of Rt. 47 and Somonauk. A spring-time dedication is desired. Additional Business: There was no further business and the meeting adjourned at 6:48 pm. Minutes respectfully submitted by Marlys Young, Minute Taker/in-person Have a question or comment about this agenda item? Call us Monday-Friday, 8:00am to 4:30pm at 630-553-4350, email us at agendas@yorkville.il.us, post at www.facebook.com/CityofYorkville, tweet us at @CityofYorkville, and/or contact any of your elected officials at http://www.yorkville.il.us/320/City-Council Agenda Item Summary Memo Title: Meeting and Date: Synopsis: Council Action Previously Taken: Date of Action: Action Taken: Item Number: Type of Vote Required: Council Action Requested: Submitted by: Agenda Item Notes: Reviewed By: Legal Finance Engineer City Administrator Community Development Purchasing Police Public Works Parks and Recreation Agenda Item Number New Business #1 Tracking Number EDC 2023-01 Building Permit Report November 2022 Economic Development Committee – January 3, 2023 Informational None All permits issued in November 2022. D. Weinert Community Development Name Department L:\Agendas - Packets\Packets\2022 Packets\Economic Development\12-06-22\Permits\Nov 2022.doc Prepared by: D Weinert UNITED CITY OF YORKVILLE BUILDING PERMIT REPORT November 2022 TYPES OF PERMITS Number of Permits Issued SFD Single Family Detached SFA Single Family Attached Multi- Family Apartments Condominiums Commercial Includes all Permits Issued for Commercial Use Industrial Misc. Construction Cost Permit Fees November 2022 86 13 22 0 2 0 49 6,406,421.00 418,035.46 Calendar Year 2022 1449 165 102 0 108 0 1074 63,603,712.00 2,520,213.00 Fiscal Year 2023 1049 105 90 0 75 0 779 44,394,327.00 2,015,926.25 November 2021 90 5 23 0 10 0 52 4,449,427.00 196,467.18 Calendar Year 2021 1604 241 160 0 123 0 1080 74,807,575.00 2,730,676.63 Fiscal Year 2022 1068 142 136 0 71 0 719 50,085,270.00 1,829,188.94 November 2020 86 14 2 0 5 0 65 3,453,154.00 118,496.64 Calendar Year 2020 1753 192 94 0 87 0 1380 54,989,730.00 2,494,231.83 Fiscal Year 2021 1366 147 90 0 47 0 1082 43,376,218.00 2,025,389.45 November 2019 129 15 16 0 15 0 83 7,099,996.00 231,270.55 Calendar Year 2019 2077 137 35 0 111 0 1794 57,029,018.00 1,785,181.17 Fiscal Year 2020 1796 89 30 0 68 0 1609 39,559,038.00 1,173,451.45 Have a question or comment about this agenda item? Call us Monday-Friday, 8:00am to 4:30pm at 630-553-4350, email us at agendas@yorkville.il.us, post at www.facebook.com/CityofYorkville, tweet us at @CityofYorkville, and/or contact any of your elected officials at http://www.yorkville.il.us/320/City-Council Agenda Item Summary Memo Title: Meeting and Date: Synopsis: Council Action Previously Taken: Date of Action: Action Taken: Item Number: Type of Vote Required: Council Action Requested: Submitted by: Agenda Item Notes: Reviewed By: Legal Finance Engineer City Administrator Community Development Purchasing Police Public Works Parks and Recreation Agenda Item Number New Business #2 Tracking Number EDC 2023-02 Building Inspection Report for November 2022 Economic Development Committee – January 3, 2023 Informational None All inspections scheduled in November 2022. D. Weinert Community Development Name Department DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 1DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 1TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------PR _____ 060-PLR PLUMBING - ROUGH 10000001 COUNTY INSPECTIONS 0 11/03/2022 Comments1: 782 ROUTE 126 PLAINFIELD (NO CONTACT #)PR _____ 061-PLF PLUMBING - FINAL OSR READ 11/04/2022 Comments1: 7485 CLUBHOUSE DRPR _____ 067-PLU PLUMBING - UNDERSLAB 11/15/2022 Comments1: 114 COUNTRY RDGH _____ 019-FIN FINAL INSPECTION 20191752 1854 WREN RD 2882 11/02/2022 Comments1: *****MODEL HOME TO OCCUPANCY***** -- JEF Comments2: F 847-456-8082GH _____ 020-FEL FINAL ELECTRIC 11/02/2022GH _____ 021-FMC FINAL MECHANICAL 11/02/2022PBF _____ 022-PLF PLUMBING - FINAL OSR READ 11/04/2022 Comments1: ***MODEL HOME TO OCCUPANCY*** - JEFF 847 Comments2: -456-8082ED _____ 023-EFL ENGINEERING - FINAL INSPE 11/04/2022ED _____ 021-EFL ENGINEERING - FINAL INSPE 20191753 1852 WREN RD 2881 11/04/2022GH _____ 022-FIN FINAL INSPECTION 11/16/2022 Comments1: JEFF 847-456-8082 -- SEE INSPECTION REPO Comments2: RTGH _____ 023-FEL FINAL ELECTRIC 01/16/2022 Comments1: SEE INSPECTION REPORTGH _____ 024-FMC FINAL MECHANICAL 11/16/2022PBF _____ 025-PLF PLUMBING - FINAL OSR READ 11/16/2022 Comments1: JEFF 847-456-8082BC _____ 004-FIN FINAL INSPECTION 20210054 898 PARKSIDE LN 191 11/29/2022 Comments1: SEE INSPECTION REPORTED _____ 023-EFL ENGINEERING - FINAL INSPE 20210149 3732 BAILEY RD 135 11/02/2022 Comments1: TEMP TO FINALED _____ 021-EFL ENGINEERING - FINAL INSPE 20210150 3734 BAILEY RD 1354 11/02/2022 Comments1: TEMP TO FINALED _____ 022-EFL ENGINEERING - FINAL INSPE 20210151 3736 BAILEY RD 1351 11/02/2022 Comments1: TEMP TO FINAL DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 2DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 2TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------ED _____ 022-EFL ENGINEERING - FINAL INSPE 20210152 3738 BAILEY RD 1352 11/02/2022 Comments1: TEMP TO FINALED _____ 021-EFL ENGINEERING - FINAL INSPE 20210153 3740 BAILEY RD 1351 11/02/2022 Comments1: TEMP TO FINAL -- DRIVEWAYED _____ 023-EFL ENGINEERING - FINAL INSPE 20210154 3722 BAILEY RD 1361 11/03/2022 Comments1: MODEL TO FINALED _____ 022-EFL ENGINEERING - FINAL INSPE 20210155 3724 BAILEY RD 1362 11/03/2022 Comments1: TEMP TO FINALED _____ 021-EFL ENGINEERING - FINAL INSPE 20210156 3726 BAILEY RD 1363 11/03/2022 Comments1: TEMP TO FINALED _____ 020-EFL ENGINEERING - FINAL INSPE 20210157 3728 BAILEY RD 1364 11/03/2022 Comments1: TEMP TO FINALED _____ 020-EFL ENGINEERING - FINAL INSPE 20210158 3730 BAILEY RD 1365 11/03/2022 Comments1: TEMP TO FINALJP _____ 011-EDA ENGINEERING - DRIVEWAY AP 20210579 3951 HAVENHILL CT 3029 11/17/2022 Comments1: 630-273-2528 SOPHIA/ABBY PROPSJP _____ 012-EPW ENGINEERING- PUBLIC WALK 11/16/2022 Comments1: 630-273-2528 ABBY/SOPHIEJP _____ 011-EDA ENGINEERING - DRIVEWAY AP 20210580 3953 HAVENHILL CT 11/17/2022 Comments1: 630-273-2528 SOPHIA/ABBY PROPSJP _____ 012-EPW ENGINEERING- PUBLIC WALK 11/16/2022JP _____ 012-EDA ENGINEERING - DRIVEWAY AP 20210581 3955 HAVENHILL CT 11/17/2022 Comments1: 630-273-2528 SOPHIA/ABBY PROPSJP _____ 013-EPW ENGINEERING- PUBLIC WALK 11/16/2022JP _____ 012-EDA ENGINEERING - DRIVEWAY AP 20210582 3957 HAVENHILL CT 11/17/2022 Comments1: 630-273-2528 SOPHIA/ABBY PROPSJP _____ 013-EPW ENGINEERING- PUBLIC WALK 11/16/2022ED _____ 020-REI REINSPECTION 20211140 1106 CARLY DR 27 11/02/2022 Comments1: EFLED _____ 022-REI REINSPECTION 20211141 966 S CARLY CIR 104 11/16/2022 Comments1: BBOX, EROSION CONTROL AT SANITARY STRUCT Comments2: URES, SEAN 630-514-9286 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 3DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 3TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------ED _____ 027-REI REINSPECTION 20211144 3986 SHOEGER CT 25 11/09/2022 Comments1: EFLED _____ 028-REI REINSPECTION 20211145 3988 SHOEGER CT 25 11/09/2022 Comments1: EFL REINSPECTED _____ 022-EFL ENGINEERING - FINAL INSPE 20211156 3841 BISSEL DR 1181 11/03/2022 Comments1: TEMP TO FINALED _____ 022-EFL ENGINEERING - FINAL INSPE 20211157 3845 BISSEL DR 1183 11/03/2022 Comments1: TEMP TO FINALED _____ 022-EFL ENGINEERING - FINAL INSPE 20211158 3843 BISSEL DR 1182 11/03/2022 Comments1: TEMP TO FINALED _____ 021-EFL ENGINEERING - FINAL INSPE 20211159 3847 BISSEL DR 1184 11/03/2022 Comments1: TEMP TO FINALED _____ 022-EFL ENGINEERING - FINAL INSPE 20211160 3849 BISSEL DR 1185 11/03/2022 Comments1: TEMP TO FINALED _____ 021-EFL ENGINEERING - FINAL INSPE 20211242 4819 W MILLBROOK CIR 152 11/09/2022 Comments1: TEMP TO FINALED _____ 024-EFL ENGINEERING - FINAL INSPE 20211272 4822 W MILLBROOK CIR 11 11/09/2022 Comments1: TEMP TO FINALED _____ 026-REI REINSPECTION 20211334 4003 BRADY ST 8 11/04/2022 Comments1: EFLBC _____ 016-FIN FINAL INSPECTION 20211464 3828 BAILEY RD 1231 11/08/2022 Comments1: MIKE 224-340-5860BC _____ 017-FEL FINAL ELECTRIC 11/08/2022BC _____ 018-FMC FINAL MECHANICAL 11/08/2022PBF _____ 019-PLF PLUMBING - FINAL OSR READ 11/08/2022 Comments1: MIKE 224-340-5860ED _____ 020-EFL ENGINEERING - FINAL INSPE 11/09/2022ED _____ 023-EFL ENGINEERING - FINAL INSPE 20211480 4814 W MILLBROOK CIR 12 11/09/2022 Comments1: TEMP TO FINALJP _____ 001-FIN FINAL INSPECTION 20211719 624 RED TAIL CT 28 11/07/2022 Comments1: SHED -- PAUL 815-501-5022 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 4DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 4TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------ED _____ 026-REI REINSPECTION 20211751 2001 PRAIRIE GRASS LN 45 11/16/2022 Comments1: RE FINAL - PKW TREE 630-973-6699ED _____ 027-ADA ADA ACCESSIBLE WALK WAY 11/16/2022GH _____ 003-FIN FINAL INSPECTION 20211757 2028 SQUIRE CIR 197 11/30/2022 Comments1: FENCEPR _____ AM 010-FIN FINAL INSPECTION 20220028 2942 GRANDE TR 419 11/28/2022 Comments1: DOROTHY 708-691-3420PR _____ AM 011-FEL FINAL ELECTRIC 11/28/2022PR _____ AM 012-FMC FINAL MECHANICAL 11/28/2022PR _____ AM 013-PLF PLUMBING - FINAL OSR READ 11/28/2022PR _____ AM 016-RMC ROUGH MECHANICAL 20220042 444 E VETERANS PKWY 11/01/2022 Comments1: HOOD 309-883-9287 BRUCEBC _____ AM 017-ELE ELECTRIC SERVICE 11/23/2022 Comments1: BRIAN 708-642-7467BC _____ 020-RFR ROUGH FRAMING 20220068 2735 ELLORY CT 131 11/15/2022 Comments1: DECK 630-988-0169 NICK/RYANBC _____ PM 021-REI REINSPECTION 11/17/2022 Comments1: DECK FRAMIMG - NICK 630-988-0169PR _____ 016-FIN FINAL INSPECTION 20220101 3495 RYAN DR 1 11/18/2022 Comments1: TIM 630-878-5291PR _____ 017-FEL FINAL ELECTRIC 11/18/2022PR _____ 018-FMC FINAL MECHANICAL 11/18/2022PR _____ 019-PLF PLUMBING - FINAL OSR READ 11/18/2022ED _____ 020-EFL ENGINEERING - FINAL INSPE 11/18/2022 Comments1: FINAL SITEED _____ 021-ADA ADA ACCESSIBLE WALK WAY 11/18/2022GH _____ AM 008-RFR ROUGH FRAMING 20220129 628 WHITE OAK WAY 59 11/08/2022 Comments1: MARK 630-816-6836 -- SEE INSPECTION REPO Comments2: RTGH _____ AM 009-REL ROUGH ELECTRICAL 11/08/2022 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 5DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 5TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ AM 010-RMC ROUGH MECHANICAL 11/08/2022 Comments1: SEE INSPECTION REPORTPBF _____ AM 011-PLR PLUMBING - ROUGH 11/08/2022 Comments1: MARK 630-816-6836GH _____ 012-GPL GREEN PLATE INSPECTION 11/08/2022GH _____ AM 013-INS INSULATION 11/15/2022 Comments1: MARK 630-816-6836 REI RFR AND RMCPR _____ PM 018-ELU ELECTRICAL - UNDERSLAB 20220130 651 PRAIRIE POINTE DR 1 11/04/2022 Comments1: FOR GENERATOR -- JASON 630-392-3382PR _____ PM 019-REL ROUGH ELECTRICAL 11/04/2022 Comments1: GENERATORPR _____ PM 020-ABC ABOVE CEILING 11/04/2022 Comments1: COUNCIL CHAMBERS -- 3RD FLOORBC _____ PM 021-PPS PRE-POUR, SLAB ON GRADE 11/10/2022 Comments1: SLABS FOR GENERATOR AND ATS. JASON 630- Comments2: 392-3382 (((CANCELLED))))PR _____ 022-PLU PLUMBING - UNDERSLAB 11/14/2022 Comments1: JASON 630-392-3382PR _____ 023-PPS PRE-POUR, SLAB ON GRADE 11/14/2022 Comments1: SLABS FOR GENERATOR AND ATS -- JASON 630 Comments2: -392-3382ED _____ 018-EFL ENGINEERING - FINAL INSPE 20220153 1956 MEADOWLARK LN 82 11/09/2022 Comments1: ADA RAMP, BBOX NOT TO GRADEPR _____ 019-FIN FINAL INSPECTION 11/04/2022 Comments1: 630-878-5792 DAVE/MCCUEPR _____ 020-FEL FINAL ELECTRIC 11/04/2022 Comments1: 630-878-5792 DAVE/MCCUEPR _____ 021-FME FINAL MECHANICAL 11/04/2022 Comments1: 630-878-5792 DAVE/MCCUEPR _____ 022-PLF PLUMBING - FINAL OSR READ 11/04/2022 Comments1: 630-878-5792 DAVE/MCCUEGH _____ 018-FIN FINAL INSPECTION 20220160 542 ASHWORTH LN 522 11/08/2022 Comments1: JEFF 847-456-8082 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 6DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 6TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ 019-FEL FINAL ELECTRIC 11/08/2022 Comments1: SEE INSPECTION REPORTGH _____ 020-FMC FINAL MECHANICAL 11/08/2022PBF _____ 021-PLF PLUMBING - FINAL OSR READ 11/08/2022 Comments1: JEFF - 847-456-8082ED _____ 022-EFL ENGINEERING - FINAL INSPE 11/10/2022ED _____ AM 016-ADA ADA ACCESSIBLE WALK WAY 20220162 2349 FAIRFIELD AVE 497 11/04/2022 Comments1: OSCAR 847-551-9066JP _____ AM 017-EPW ENGINEERING- PUBLIC WALK 11/04/2022 Comments1: OSCAR 847-551-9066JP _____ AM 018-WK SERVICE WALK 11/04/2022BC _____ 017-FIN FINAL INSPECTION 20220163 502 ASHWORTH LN 520 11/15/2022 Comments1: JEFF 847-456-8082BC _____ 018-FEL FINAL ELECTRIC 11/15/2022BC _____ 019-FMC FINAL MECHANICAL 11/15/2022PBF _____ 020-PLF PLUMBING - FINAL OSR READ 11/15/2022 Comments1: JEFF 847-456-8082ED _____ 021-EFL ENGINEERING - FINAL INSPE 11/16/2022GH _____ 017-EPW ENGINEERING- PUBLIC WALK 20220164 522 ASHWORTH LN 521 11/01/2022GH _____ 018-WK SERVICE WALK 11/01/2022BC _____ 019-FIN FINAL INSPECTION 20220165 572 ASHWORTH LN 523 11/07/2022 Comments1: JEFF 847-456-8082BC _____ 020-FEL FINAL ELECTRIC 11/07/2022BC _____ 021-FMC FINAL MECHANICAL 11/07/2022PBF _____ 022-PLF PLUMBING - FINAL OSR READ 11/07/2022 Comments1: JEFF 847-456-8082ED _____ 023-EFL ENGINEERING - FINAL INSPE 11/10/2022GH _____ 015-INS INSULATION 20220167 2387 FAIRFIELD AVE 494 11/02/2022 Comments1: JEFF 847-456-8082 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 7DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 7TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------JP _____ AM 017-EPW ENGINEERING- PUBLIC WALK 11/08/2022 Comments1: JUAN 847-551-9066JP _____ AM 018-WK SERVICE WALK 11/08/2022JP _____ 007-GPL GREEN PLATE INSPECTION 20220178 555 BRAEMORE LN 532 11/08/2022 Comments1: JEFF - 847-456-8082PBF _____ 008-SUM SUMP 11/29/2022 Comments1: CATHY 630-387-2001GH _____ 019-FIN FINAL INSPECTION 20220179 505 BRAEMORE LN 534 11/16/2022 Comments1: JEFF 847-456-8082 SEE INSPECTION REPORTGH _____ 020-FEL FINAL ELECTRIC 11/16/2022GH _____ 021-FMC FINAL MECHANICAL 11/16/2022PBF _____ 022-PLF PLUMBING - FINAL OSR READ 11/16/2022 Comments1: JEFF 847-456-8082ED _____ 023-EFL ENGINEERING - FINAL INSPE 11/16/2022 Comments1: CLEAN WALKS AND STREETSPBF _____ 009-SUM SUMP 20220180 525 BRAEMORE LN 533 11/09/2022 Comments1: CATHY 630-387-2001JP _____ AM 010-EPW ENGINEERING- PUBLIC WALK 11/15/2022 Comments1: COMEXGH _____ AM 009-STP STOOP 20220181 605 BRAEMORE LN 531 11/03/2022 Comments1: FR AND REAR -- JUAN 847-551-9066JP _____ AM 010-WK SERVICE WALK 11/15/2022 Comments1: COMEXBC _____ 011-RFR ROUGH FRAMING 11/29/2022 Comments1: JEFF 847-456-8082BC _____ 012-REL ROUGH ELECTRICAL 11/29/2022BC _____ 013-RMC ROUGH MECHANICAL 11/29/2022PBF _____ 014-PLR PLUMBING - ROUGH 11/29/2022 Comments1: JEFF 847-456-8082BC _____ 019-FIN FINAL INSPECTION 20220182 602 ASHWORTH LN 524 11/18/2022 Comments1: JEFF 847-456-8082 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 8DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 8TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BC _____ 020-FEL FINAL ELECTRIC 11/18/2022BC _____ 021-FMC FINAL MECHANICAL 11/18/2022PBF _____ 022-PLF PLUMBING - FINAL OSR READ 11/18/2022 Comments1: JEFF 847-456-8082ED _____ 023-EFL ENGINEERING - FINAL INSPE 11/18/2022GH _____ 017-FIN FINAL INSPECTION 20220185 2736 ELLORY CT 134 11/01/2022 Comments1: ANDREW 331-431-7342 -- SEE INSPECTION RE Comments2: PORTGH _____ 018-FEL FINAL ELECTRIC 11/01/2022GH _____ 019-FMC FINAL MECHANICAL 11/01/2022PBF _____ 020-PLF PLUMBING - FINAL OSR READ 11/01/2022 Comments1: ANDREW 331-431-7342ED _____ 021-EFL ENGINEERING - FINAL INSPE 11/03/2022PBF _____ 022-REI REINSPECTION 11/02/2022 Comments1: PLUMBING FINAL -- ANDREW 331-431-7342GH _____ 019-FIN FINAL INSPECTION 20220186 2728 ELLORY CT 138 11/01/2022 Comments1: ANDREW 331-431-7342 -- SEE INSPECTION RE Comments2: PORTGH _____ 020-FEL FINAL ELECTRIC 11/01/2022GH _____ 021-FMC FINAL MECHANICAL 11/01/2022PBF _____ 022-PLF PLUMBING - FINAL OSR READ 11/01/2022 Comments1: ANDREW 331-431-7342ED _____ 023-EFL ENGINEERING - FINAL INSPE 11/03/2022GH _____ 018-FIN FINAL INSPECTION 20220192 2638 KELLOGG CT 46 11/07/2022 Comments1: ANDREW 331-431-7342 SEE INSPECTION REPOR Comments2: TGH _____ 019-FEL FINAL ELECTRIC 11/07/2022GH _____ 020-FMC FINAL MECHANICAL 11/07/2022PBF _____ 021-PLF PLUMBING - FINAL OSR READ 11/07/2022 Comments1: ANDREW 331-431-7342 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 9DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 9TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------ED _____ 022-EFL ENGINEERING - FINAL INSPE 11/09/2022GH _____ 017-FIN FINAL INSPECTION 20220283 2731 ELLORY CT 129 11/18/2022 Comments1: ANDREW 331-431-7342GH _____ 018-FEL FINAL ELECTRIC 11/18/2022GH _____ 019-FMC FINAL MECHANICAL 11/18/2022PBF _____ 020-PLF PLUMBING - FINAL OSR READ 11/18/2022 Comments1: ANDREW 331-431-7342ED _____ 021-EFL ENGINEERING - FINAL INSPE 11/18/2022 Comments1: FILL LOW SPOT IN SPRINGGH _____ PM 022-REI REINSPECTION 11/21/2022 Comments1: FEL -- NICK 630-988-0169ED _____ 020-REI REINSPECTION 20220291 1222 CANNONBALL TR 1 11/16/2022 Comments1: PARKWAY TREE-- PLANTEDED _____ 018-EFL ENGINEERING - FINAL INSPE 20220329 1844 WREN RD 287-2 11/04/2022GH _____ 019-FIN FINAL INSPECTION 11/03/2022 Comments1: JEFF 847-456-8082 -- SEE INSPECTION REPO Comments2: RTGH _____ 020-FEL FINAL ELECTRIC 11/03/2022GH _____ 021-FMC FINAL MECHANICAL 11/03/2022PBF _____ 022-PLF PLUMBING - FINAL OSR READ 11/04/2022 Comments1: JEFF 847-456-8082ED _____ 017-EFL ENGINEERING - FINAL INSPE 20220330 1846 WREN RD 287-3 11/04/2022GH _____ 018-FIN FINAL INSPECTION 11/14/2022 Comments1: JEFF - 847-456-8082 -- SEE INSPECTION RE Comments2: PORTGH _____ 019-FEL FINAL ELECTRIC 11/14/2022GH _____ 020-FMC FINAL MECHANICAL 11/14/2022PBF _____ 021-PLF PLUMBING - FINAL OSR READ 11/14/2022 Comments1: JEFF 847-456-8280ED _____ 017-EFL ENGINEERING - FINAL INSPE 20220331 1848 WREN RD 287-4 11/04/2022 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 10DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 10TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ 018-FIN FINAL INSPECTION 11/14/2022 Comments1: JEFF 847-456-8280 - SEE INSPECTION REPOR Comments2: TGH _____ 019-FEL FINAL ELECTRIC 11/14/2022GH _____ 020-FMC FINAL MECHANICAL 11/14/2022PBF _____ 021-PLF PLUMBING - FINAL OSR READ 11/14/2022 Comments1: JEFF 847-456-8280JP 13:00 001-PHF POST HOLE - FENCE 20220333 1242 TAUS CIR 121 11/14/2022 Comments1: CARLA --815-460-3449JP _____ AM 010-EPW ENGINEERING- PUBLIC WALK 20220335 3138 BOOMBAH BLVD 127 11/08/2022 Comments1: EARLY AM PLEASE -- KEN 630-546-0735BC _____ 009-RFR ROUGH FRAMING 20220351 3746 BISSEL DR 131-1 11/08/2022 Comments1: CHRIS 224-358-1606BC _____ 010-REL ROUGH ELECTRICAL 11/08/2022BC _____ 011-RMC ROUGH MECHANICAL 11/08/2022PBF _____ 012-PLR PLUMBING - ROUGH 11/08/2022 Comments1: CHRIS 224-358-1606GH _____ 013-INS INSULATION 11/14/2022 Comments1: CHRIS 224-358-1606 - SEE INSPECTION REPO Comments2: RTGH _____ 009-RFR ROUGH FRAMING 20220352 3744 BISSEL DR 131-2 11/09/2022 Comments1: CHRIS 224-358-1606 --- SEE INSPECTION RE Comments2: PORTGH _____ 010-REL ROUGH ELECTRICAL 11/09/2022GH _____ 011-RMC ROUGH MECHANICAL 11/09/2022PBF _____ 012-PLR PLUMBING - ROUGH 11/09/2022 Comments1: 224-358-1606 - CHRISGH _____ 013-INS INSULATION 11/14/2022 Comments1: CHRIS 224-358-1606 - SEE INSPECTION REPO Comments2: RTBC _____ 009-RFR ROUGH FRAMING 20220353 3742 BISSEL DR 131-3 11/17/2022 Comments1: CHRIS 224-358-1606 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 11DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 11TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BC _____ 010-REL ROUGH ELECTRICAL 11/17/2022BC _____ 011-RMC ROUGH MECHANICAL 11/17/2022PBF _____ 012-PLR PLUMBING - ROUGH 11/17/2022 Comments1: CHRIS 224-358-1606GH _____ 013-INS INSULATION 11/29/2022 Comments1: CHRIS 224-358-1606 SEE INSPECTION REPORTBC _____ AM 012-INS INSULATION 20220359 3734 BISSEL DR 1324 11/01/2022 Comments1: CHRIS 224-358-1606ED _____ 017-EFL ENGINEERING - FINAL INSPE 20220371 3083 GRANDE TR 552 11/10/2022BC _____ 018-FIN FINAL INSPECTION 11/16/2022 Comments1: JIM 331-223-6615BC _____ 019-FEL FINAL ELECTRIC 11/16/2022BC _____ 020-FMC FINAL MECHANICAL 11/16/2022PBF _____ 021-PLF PLUMBING - FINAL OSR READ 11/16/2022 Comments1: JIM 331-223-6615ED _____ 017-EFL ENGINEERING - FINAL INSPE 20220372 3062 GRANDE TR 542 11/02/2022GH _____ 018-FIN FINAL INSPECTION 11/08/2022 Comments1: JIM 331-223-6615GH _____ 019-FEL FINAL ELECTRIC 11/08/2022 Comments1: SEE INSPECTION REPORTGH _____ 020-FMC FINAL MECHANICAL 11/08/2022PBF _____ 021-PLF PLUMBING - FINAL OSR READ 11/08/2022 Comments1: JIM 331-223-6615GH _____ 002-FIN FINAL INSPECTION 20220378 2775 CROOKER DR 61 11/30/2022 Comments1: FENCEGH _____ AM 009-STP STOOP 20220400 642 ASHWORTH LN 526 11/03/2022 Comments1: FRONT -- JUAN 847-551-9066GH _____ AM 010-PHD POST HOLE - DECK 11/03/2022JP _____ AM 011-WK SERVICE WALK 11/08/2022 Comments1: JUAN 847-551-9066 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 12DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 12TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BC _____ 012-RFR ROUGH FRAMING 11/15/2022 Comments1: JEFF 847-456-8082BC _____ 013-REL ROUGH ELECTRICAL 11/15/2022BC _____ 014-RMC ROUGH MECHANICAL 11/15/2022PBF _____ 015-PLR PLUMBING - ROUGH 11/15/2022 Comments1: JEFF 847-456-8082BC _____ 016-INS INSULATION 11/18/2022 Comments1: JEFF 847-456-8082PBF _____ 017-REI REINSPECTION 11/17/2022 Comments1: ROUGH PLUMBING -- JEFF 847-456-8082PBF _____ 008-SUM SUMP 20220401 608 BRAEMORE LN 537 11/09/2022 Comments1: CATHY 630-387-2001JP _____ AM 009-EPW ENGINEERING- PUBLIC WALK 11/10/2022 Comments1: JUAN 847-551-9066JP _____ AM 009-EPW ENGINEERING- PUBLIC WALK 20220402 665 BRAEMORE LN 528 11/02/2022 Comments1: JUAN 847-551-9066GH _____ 010-GPL GREEN PLATE INSPECTION 11/14/2022 Comments1: JEFF 847-456-8082 - SEE INSPECTION REPOR Comments2: TGH _____ 010-STP STOOP 20220403 538 BRAEMORE LN 536 11/03/2022 Comments1: FR AND R -- SEE INSPECTION REPORTPBF _____ 011-SUM SUMP 11/09/2022 Comments1: CATHY 630-387-2001JP _____ AM 012-WK SERVICE WALK 11/10/2022 Comments1: JUAN 847-551-9066BC _____ 013-RFR ROUGH FRAMING 11/18/2022 Comments1: JEFF 847-456-8082BC _____ 014-REL ROUGH ELECTRICAL 11/18/2022BC _____ 015-RMC ROUGH MECHANICAL 11/18/2022PBF _____ 016-PLR PLUMBING - ROUGH 11/18/2022 Comments1: JEFF 847-456-8082 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 13DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 13TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ 017-INS INSULATION 11/23/2022 Comments1: JEFF 847-456-8082PBF _____ 009-SUM SUMP 20220404 668 BRAEMORE LN 539 11/09/2022 Comments1: CATHY 630-387-2001JP _____ AM 010-STP STOOP 11/15/2022 Comments1: CANCELGH _____ AM 011-STP STOOP 11/21/2022 Comments1: FR & R -- JUAN 847-551-9066JP _____ AM 008-EPW ENGINEERING- PUBLIC WALK 20220405 622 ASHWORTH LN 525 11/08/2022 Comments1: JUAN 847-551-9066GH _____ 008-GPL GREEN PLATE INSPECTION 20220406 2456 RICHMOND AVE 483 11/01/2022 Comments1: JEFF --- 847-456-8082GH _____ 013-RFR ROUGH FRAMING 20220407 2451 FAIRFIELD AVE 488 11/02/2022 Comments1: JEFF 847-456-8082 -- SEE INSPECTION REPO Comments2: RTGH _____ 014-REL ROUGH ELECTRICAL 11/02/2022GH _____ 015-RMC ROUGH MECHANICAL 11/02/2022PBF _____ 016-PLR PLUMBING - ROUGH 11/02/2022 Comments1: JEFF 847-456-8082BC _____ 017-INS INSULATION 11/07/2022 Comments1: JEFF 847-456-8082JP _____ AM 018-EPW ENGINEERING- PUBLIC WALK 11/10/2022 Comments1: JUAN 847-551-9066JP _____ AM 019-WK SERVICE WALK 11/10/2022 Comments1: JUAN 847-551-9066JP _____ AM 009-EPW ENGINEERING- PUBLIC WALK 20220408 2294 RICHMOND AVE 476 11/04/2022 Comments1: OSCAR 847-551-9066ED _____ 010-ADA ADA ACCESSIBLE WALK WAY 11/04/2022GH _____ 011-RFR ROUGH FRAMING 20220409 648 BRAEMORE LN 538 11/09/2022 Comments1: JEFF 847-456-8082GH _____ 012-REL ROUGH ELECTRICAL 11/09/2022 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 14DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 14TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ 013-RMC ROUGH MECHANICAL 11/09/2022PBF _____ 014-PLR PLUMBING - ROUGH 11/09/2022 Comments1: JEFF 847-456-8082GH _____ 015-INS INSULATION 11/14/2022 Comments1: JEFF 847-456-8082 - SEE INSPECTION REPOR Comments2: TPBF _____ PM 016-SUM SUMP 11/09/2022 Comments1: CATHY 630-387-2001JP _____ AM 017-WK SERVICE WALK 11/10/2022 Comments1: JUAN 847-551-9066JP _____ AM 018-EPW ENGINEERING- PUBLIC WALK 11/15/2022 Comments1: CANCELPR _____ AM 009-MIS MISCELLANEOUS 20220474 1555 W CORNEILS RD 11/16/2022 Comments1: RAY - 314-591-6038 -- WOULD LIKE TO GO O Comments2: VER THE PROGRESS OF THE CONSTRUCTION.GH _____ 018-FIN FINAL INSPECTION 20220476 3121 GRANDE TR 492 11/23/2022 Comments1: AUSTIN 630-720-1287GH _____ 019-FEL FINAL ELECTRIC 11/23/2022GH _____ 020-FMC FINAL MECHANICAL 11/23/2022PBF _____ 021-PLF PLUMBING - FINAL OSR READ 11/23/2022 Comments1: AUSTIN 630-720-1287ED _____ 022-EFL ENGINEERING - FINAL INSPE 11/29/2022JP _____ AM 008-EPW ENGINEERING- PUBLIC WALK 20220477 2705 NICKERSON CT 159 11/04/2022 Comments1: MIDWESTERN 815-839-8175 -- SEE INSPETION Comments2: REPORTJP _____ AM 009-WK SERVICE WALK 11/04/2022GH _____ 010-RFR ROUGH FRAMING 11/07/2022 Comments1: ANDREW 331-431-7342 - SEE INSPECTION REP Comments2: ORTGH _____ 011-REL ROUGH ELECTRICAL 11/07/2022GH _____ 012-RMC ROUGH MECHANICAL 11/07/2022 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 15DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 15TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------PBF _____ 013-PLR PLUMBING - ROUGH 11/07/2022 Comments1: ANDREW 331-431-7342GH _____ AM 014-INS INSULATION 11/09/2022 Comments1: ANDREW 331-431-7342GH _____ 015-EPW ENGINEERING- PUBLIC WALK 11/09/2022 Comments1: MIDWESTERN 815-839-8175GH _____ 016-WK SERVICE WALK 11/09/2022 Comments1: MIDWESTERN 815-839-8175GH _____ 017-FIN FINAL INSPECTION 20220478 4775 W MILLBROOK CIR 150 11/29/2022 Comments1: ANDREW 331-431-7342GH _____ 018-FEL FINAL ELECTRIC 11/29/2022GH _____ 019-FMC FINAL MECHANICAL 11/29/2022PBF _____ 020-PLF PLUMBING - FINAL OSR READ 11/29/2022 Comments1: ANDREW 331-431-7342ED _____ 021-EFL ENGINEERING - FINAL INSPE 11/29/2022BC _____ 002-FIN FINAL INSPECTION 20220504 2223 RICHMOND AVE 443 11/02/2022 Comments1: DECK 630-244-2390 TOM ROONEY BLDRSBC _____ 017-FIN FINAL INSPECTION 20220519 2805 BERRYWOOD LN 798 11/08/2022 Comments1: MIKE 224-340-5860BC _____ 018-FEL FINAL ELECTRIC 11/08/2022BC _____ 019-FMC FINAL MECHANICAL 11/08/2022PBF _____ 020-PLF PLUMBING - FINAL OSR READ 11/08/2022 Comments1: MIKE - 224-340-5860ED _____ 021-EFL ENGINEERING - FINAL INSPE 11/09/2022ED _____ 022-REI REINSPECTION 11/10/2022 Comments1: EFL RE-INSPECT -- DRAINAGE IN YARDGH _____ 019-FIN FINAL INSPECTION 20220520 2801 BERRYWOOD LN 797 11/15/2022 Comments1: MIKE -- 224-340-5860GH _____ 020-FEL FINAL ELECTRIC 11/15/2022 Comments1: SEE INSPECTION REPORT DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 16DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 16TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ 021-FMC FINAL MECHANICAL 11/15/2022PBF _____ 022-PLF PLUMBING - FINAL OSR READ 11/15/2022 Comments1: MIKE 224-340-5860ED _____ 023-EFL ENGINEERING - FINAL INSPE 11/16/2022GH _____ 014-FIN FINAL INSPECTION 20220522 3352 SEELEY ST 727 11/22/2022 Comments1: MIKE 224-340-5860 -- SEE INSPECTION REPO Comments2: RTGH _____ 015-FEL FINAL ELECTRIC 11/22/2022GH _____ 016-FMC FINAL MECHANICAL 11/22/2022PBF _____ 017-PLF PLUMBING - FINAL OSR READ 11/22/2022 Comments1: MIKE 224-340-5860 -- DID NOT HAVE ACCESS Comments2: TO PROPERTYED _____ 018-EFL ENGINEERING - FINAL INSPE 11/23/2022GH _____ PM 019-REI REINSPECTION 11/23/2022 Comments1: FINAL FRAMING -- MIKE 224-340-5860PBF _____ AM 020-REI REINSPECTION 11/28/2022 Comments1: FINAL PLUMBING -- MIKE 224-340-5860 ***P Comments2: LEASE GO AS EARLY AS POSSIBLE******GH _____ 002-FIN FINAL INSPECTION 20220535 4064 SHOEGER CT 29 11/30/2022 Comments1: FENCEBC _____ 009-RFR ROUGH FRAMING 20220544 2718 POTTER CT 147 11/29/2022 Comments1: NICK 630-988-0169BC _____ 010-REL ROUGH ELECTRICAL 11/29/2022BC _____ 011-RMC ROUGH MECHANICAL 11/29/2022PBF _____ 012-PLR PLUMBING - ROUGH 11/29/2022 Comments1: NICK 630-988-0169BC _____ 003-FIN FINAL INSPECTION 20220555 407 BRUELL ST 11/01/2022 Comments1: DECK 815-712-6086 JIM -- SEE INSPECTION Comments2: REPORTBC _____ AM 002-RFR ROUGH FRAMING 20220556 903 BEHRENS ST 30 11/22/2022 Comments1: FLOOR FRAMING --SHARON 630-916-0325 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 17DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 17TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ PM 001-FTG FOOTING 20220561 2726 ELLORY CT 139 11/02/2022 Comments1: MIDWESTERN 815-839-8175 ((((((CANCELLED) Comments2: ))))GH _____ PM 002-FTG FOOTING 11/03/2022 Comments1: MIDWESTERN 815-839-8175BC _____ 003-FOU FOUNDATION 11/07/2022 Comments1: MIDWESTERN 815-839-8175BC _____ PM 004-BKF BACKFILL 11/10/2022 Comments1: MIDWESTERN 815-839-8175PBF _____ PM 005-WAT WATER 11/16/2022 Comments1: 630-492-7635 AL'S****** B&F NOT CHARGING Comments2: FOR REI FEE******INSPECTOR WENT TOO EAR Comments3: LYPBF _____ AM 006-WAT WATER 11/17/2022 Comments1: AL'S - 630-492-7635JP _____ 004-FIN FINAL INSPECTION 20220562 1382 SPRING ST 214 11/14/2022 Comments1: ROOF STEVE 630-383-6450BC _____ 004-REI REINSPECTION 20220588 4822 W MILLBROOK CIR 11 11/22/2022 Comments1: DECK LATERAL LOADSPBF _____ 008-SUM SUMP 20220650 2444 FAIRFIELD AVE 541 11/29/2022 Comments1: CATHY 630-387-2001GH _____ 008-REI REINSPECTION 20220653 2428 RICHMOND AVE 482 11/01/2022 Comments1: BASEMENT FLOOR -- OSCAR 847-551-9066GH _____ 009-REI REINSPECTION 11/01/2022 Comments1: GARAGE FLOOR - SEE INSPECTION REPORTPBF _____ 010-SUM SUMP 11/29/2022 Comments1: CATHY 630-387-2001BC _____ 009-PHD POST HOLE - DECK 20220654 2632 KELLOGG CT 43 11/07/2022 Comments1: MIDWESTERN 815-839-8175GH _____ PM 010-RFR ROUGH FRAMING 11/15/2022 Comments1: NICK 630-988-0169GH _____ PM 011-REL ROUGH ELECTRICAL 11/15/2022 Comments1: MISSING OUTLET AT RADON PIPE IN ATTIC DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 18DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 18TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ PM 012-RMC ROUGH MECHANICAL 11/15/2022PBF _____ PM 013-PLR PLUMBING - ROUGH 11/15/2022 Comments1: NICK 630-988-0169GH _____ 015-REI REINSPECTION 11/15/2022 Comments1: ROUGH ELECTRICJP _____ AM 016-PPS PRE-POUR, SLAB ON GRADE 11/16/2022 Comments1: 815-839-8175 HANNAH/MIDWEST LOUIEGH _____ 017-INS INSULATION 11/18/2022 Comments1: 630-988-0169 NICK/RYANBC _____ 018-REI REINSPECTION 11/17/2022 Comments1: RADON PIPE ROUGH PLUMB 630-988-0169 NICK Comments2: /RYANBC _____ PM 001-FTG FOOTING 20220655 2724 POTTER CT 144 11/17/2022 Comments1: MIDWESTERN 815-839-8175BC _____ AM 002-FOU FOUNDATION 11/21/2022 Comments1: MIDWESTERN 815-839-8175PBF _____ PM 003-WAT WATER 11/29/2022 Comments1: ALS -- 630-492-7635BC _____ AM 004-BKF BACKFILL 11/29/2022 Comments1: MIDWESTERN 815-839-8175GH _____ AM 009-EPW ENGINEERING- PUBLIC WALK 20220657 662 ASHWORTH LN 527 11/03/2022 Comments1: JUAN 847-551-9066ED _____ 010-ADA ADA ACCESSIBLE WALK WAY 11/03/2022BC _____ 003-FIN FINAL INSPECTION 20220660 4898 W MILLBROOK CIR 1 11/02/2022 Comments1: JACOB 630-854--8617JP _____ 001-FIN FINAL INSPECTION 20220695 303 WOODWORTH ST 11/14/2022 Comments1: WINDOWS BILL WEEKS/HOMEOWNER NO # PROVID Comments2: EDBC _____ 003-FIN FINAL INSPECTION 20220706 467 SUTTON ST 209 11/07/2022 Comments1: DECK -- SCOTT 847-858-1773 - SEE INSPECT Comments2: ION REPORTBC _____ PM 003-REI REINSPECTION 20220715 2066 SQUIRE CIR 186 11/28/2022 Comments1: SOLAR- MIKE 708-845-8715 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 19DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 19TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BC _____ PM 004-REI REINSPECTION 11/28/2022 Comments1: FINAL ELECTRIC -SOLARJP 12:00 006-ROF ROOF UNDERLAYMENT ICE & W 20220737 2273 CRYDER CT 434 11/11/2022 Comments1: MARIUZ 630-768-0957 AND PAUL 630-774-00 Comments2: 91JP _____ 007-FIN FINAL INSPECTION 11/28/2022 Comments1: PAUL 630-774-0091BC _____ 015-INS INSULATION 20220739 2810 BERRYWOOD LN 826 11/01/2022 Comments1: CHRIS 224-358-1606JP _____ 014-EPW ENGINEERING- PUBLIC WALK 20220742 3340 SEELEY ST 730 11/09/2022 Comments1: CHRIS 224-358-1606JP _____ 015-WK SERVICE WALK 11/09/2022ED _____ 016-ADA ADA ACCESSIBLE WALK WAY 11/10/2022 Comments1: CHRIS 224-358-1606JP _____ 016-EPW ENGINEERING- PUBLIC WALK 20220743 2687 SEELEY ST 825 11/09/2022 Comments1: CHRIS 224-358-1606JP _____ 017-WK SERVICE WALK 11/09/2022ED _____ 018-ADA ADA ACCESSIBLE WALK WAY 11/10/2022GH _____ 002-FIN FINAL INSPECTION 20220782 2062 SQUIRE CIR 187 11/30/2022 Comments1: FENCEPBF _____ 007-PLU PLUMBING - UNDERSLAB 20220783 2701 NICKERSON CT 157 11/10/2022 Comments1: ANDREW 331-431-7342GH _____ AM 008-PPS PRE-POUR, SLAB ON GRADE 11/15/2022 Comments1: MIDWESTERN 815-839-8175GH _____ AM 009-GAR GARAGE FLOOR 11/15/2022 Comments1: ADD VAPOR BARRIER BEFORE POURINGGH _____ AM 010-STP STOOP 11/15/2022 Comments1: FRONT & REAR ADJUST FORMS FOR BACK STOOP Comments2: - 36" AT FOUNDATION, ONLY 35" AT OUTSID Comments3: EPBF _____ PM 004-ESW ENGINEERING - SEWER / WAT 20220784 2732 ELLORY CT 136 11/07/2022 Comments1: AL'S 630-492-7635 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 20DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 20TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BC _____ PM 005-BKF BACKFILL 11/04/2022 Comments1: MIDWESTERN 815-839-8175PBF _____ AM 006-WAT WATER 11/08/2022 Comments1: 630-492-7635 AL'S/LOUISEJP _____ AM 011-STP STOOP 20220816 2437 FAIRFIELD AVE 489 11/10/2022 Comments1: FRONT -- JUAN 847-551-9066JP _____ AM 012-PHD POST HOLE - DECK 11/21/2022 Comments1: JUAN 847-551-9066JP _____ 001-PHF POST HOLE - FENCE 20220820 2004 OLD GLORY CT 234 11/28/2022 Comments1: CLASSIC 630-551-3400GH _____ AM 014-EPW ENGINEERING- PUBLIC WALK 20220825 808 BRISTOL AVE 5 11/07/2022 Comments1: GARY 630-977-1868GH _____ AM 015-WK SERVICE WALK 11/07/2022PR _____ 016-FIN FINAL INSPECTION 11/17/2022 Comments1: MARKER 630-977-1869PR _____ 017-FEL FINAL ELECTRIC 11/17/2022 Comments1: MARKER 630-977-1869PR _____ 018-FME FINAL MECHANICAL 11/17/2022 Comments1: MARKER 630-977-1869PR _____ 019-PLF PLUMBING - FINAL OSR READ 11/17/2022 Comments1: MARKER 630-977-1869ED _____ 020-EFL ENGINEERING - FINAL INSPE 11/23/2022JP 13:00 AM 001-PHF POST HOLE - FENCE 20220868 2777 CRANSTON CIR 137 11/16/2022 Comments1: LATE AM -- MARGARET 630-491-6048 -- ((NO Comments2: T READY)))))JP 13:00 002-PHF POST HOLE - FENCE 11/17/2022 Comments1: MARGARET -- 630-491-6048BC _____ AM 006-BSM BASEMENT FLOOR 20220881 809 ALEXANDRA LN 12 11/10/2022 Comments1: GARY 630-977-1868BC _____ 007-GAR GARAGE FLOOR 11/10/2022BC _____ 008-STP STOOP 11/10/2022 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 21DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 21TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------ED _____ 019-EFL ENGINEERING - FINAL INSPE 20220882 3039 GRANDE TR 529 11/29/2022GH _____ AM 001-FTG FOOTING 20220883 2646 KELLOGG CT 50 11/23/2022 Comments1: MIDWESTERN 815-839-8175BC _____ PM 002-FOU FOUNDATION 11/28/2022 Comments1: MIDWESTERN 815-839-8175PR _____ PM 003-WAT WATER 11/30/2022 Comments1: 630-492-7635 AL'S FAMILY PLUMB (((CANCEL Comments2: LED))))BF _____ PM 005-FIN FINAL INSPECTION 20220890 2719 POTTER CT 141 11/08/2022 Comments1: SOLAR -- ******PLEASE CALL WHEN ON YOUR Comments2: WAY SCOTT 847-850-9585******BF _____ PM 006-FEL FINAL ELECTRIC 11/08/2022BF _____ PM 001-FIN FINAL INSPECTION 20220900 4830 W MILLBROOK CIR 10 11/16/2022 Comments1: SOLAR -- AMY 815-584-7988BF _____ PM 002-FEL FINAL ELECTRIC 11/16/2022 Comments1: ****DONT SCHEDULE REINSPECT. UNTIL FEE I Comments2: S PAID****BC _____ 009-RFR ROUGH FRAMING 20220909 2802 BERRYWOOD LN 828 11/14/2022 Comments1: CHRIS 224-358-1606BC _____ 010-REL ROUGH ELECTRICAL 11/14/2022BC _____ 011-RMC ROUGH MECHANICAL 11/14/2022PBF _____ 012-PLR PLUMBING - ROUGH 11/14/2022 Comments1: CHRIS 224-358-1606GH _____ 013-INS INSULATION 11/16/2022 Comments1: 224-358-1606 CHRIS/DR HORTON -- SEE INSP Comments2: ECTION REPORTGH _____ 009-RFR ROUGH FRAMING 20220910 2798 BERRYWOOD LN 829 11/17/2022 Comments1: CHRIS 224-358-1606 -- SEE INSPECTION REP Comments2: ORTGH _____ 010-REL ROUGH ELECTRICAL 11/17/2022GH _____ 011-RMC ROUGH MECHANICAL 11/17/2022PBF _____ 012-PLR PLUMBING - ROUGH 11/17/2022 Comments1: CHRIS 224-358-1606 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 22DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 22TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ 013-INS INSULATION 11/21/2022 Comments1: CHRIS 224-358-1606GH _____ 009-RFR ROUGH FRAMING 20220911 2794 BERRYWOOD LN 830 11/29/2022 Comments1: CHRIS 224-358-1606 - SEE INSPECTION REPO Comments2: RTGH _____ 010-REL ROUGH ELECTRICAL 11/29/2022GH _____ 011-RMC ROUGH MECHANICAL 11/29/2022PBF _____ 012-PLR PLUMBING - ROUGH 11/29/2022 Comments1: CHRIS 224-358-1606GH _____ 009-RFR ROUGH FRAMING 20220912 2788 BERRYWOOD LN 831 11/30/2022 Comments1: CHRIS 224-358-1606 SEE INSPECTION REPORTGH _____ 010-REL ROUGH ELECTRICAL 11/30/2022GH _____ 011-RMC ROUGH MECHANICAL 11/30/2022PR _____ 012-PLR PLUMBING - ROUGH 11/30/2022 Comments1: CHRIS 224-358-1606GH _____ 009-RFR ROUGH FRAMING 20220913 2806 BERRYWOOD LN 827 11/03/2022 Comments1: CHRIS 224-358-1606 - SEE INSPECTION REPO Comments2: RTGH _____ 010-REL ROUGH ELECTRICAL 11/03/2022GH _____ 011-RMC ROUGH MECHANICAL 11/03/2022PBF _____ 012-PLR PLUMBING - ROUGH 11/03/2022 Comments1: CHRIS 224-358-1606GH _____ 013-INS INSULATION 11/09/2022 Comments1: CHRIS 224-358-1606 -- SEE INSPECTION REP Comments2: ORTPBF _____ 006-PLU PLUMBING - UNDERSLAB 20220939 2720 POTTER CT 146 11/01/2022 Comments1: ANDREW 331-431-7342BC _____ PM 007-GAR GARAGE FLOOR 11/10/2022 Comments1: MIDWESTERN 815-839-8175BC _____ PM 008-PPS PRE-POUR, SLAB ON GRADE 11/10/2022 Comments1: MIDWESERN 815-839-8175 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 23DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 23TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BC _____ 009-STP STOOP 11/10/2022BC _____ PM 003-RFR ROUGH FRAMING 20220943 2719 POTTER CT 141 11/08/2022 Comments1: ADDITION / MIKE -- SEE INSPECTION REPORTBC _____ 004-REL ROUGH ELECTRICAL 11/08/2022 Comments1: ADDITIONBC _____ PM 005-INS INSULATION 11/10/2022 Comments1: SUNROOM/ADDITION 630-772-9292 MIKEBC _____ 001-FTG FOOTING 20220954 444 E VETERANS PKWY 11/10/2022 Comments1: DRIVE THRU CLEARANCE SIGN POLE 630-363-8 Comments2: 893 VANESSA/GRAND ELECTRICPR _____ 010-RFR ROUGH FRAMING 20220984 1081 BLACKBERRY SHORE LN 42 11/22/2022 Comments1: DAVE 630-878-5792PR _____ 011-REL ROUGH ELECTRICAL 11/22/2022PR _____ 012-RMC ROUGH MECHANICAL 11/22/2022PR _____ 013-PLR PLUMBING - ROUGH 11/22/2022BC _____ AM 014-INS INSULATION 11/30/2022 Comments1: DAVE 630-878-5792BC _____ AM 006-RFR ROUGH FRAMING 20220990 301 CHURCH ST 11/09/2022 Comments1: CARMELLA 630-364-0224BC _____ AM 007-REL ROUGH ELECTRICAL 11/09/2022BC _____ 008-RMC ROUGH MECHANICAL 11/09/2022JP _____ PM 009-WK SERVICE WALK 11/10/2022 Comments1: CLEAN EDGE 630-364-0224BC _____ 010-INS INSULATION 11/14/2022BC _____ AM 007-BSM BASEMENT FLOOR 20220993 1372 E SPRING ST 217 11/01/2022 Comments1: KEN 630-546-0735JP _____ AM 009-STP STOOP 11/10/2022 Comments1: KEN 630-546-0735JP _____ AM 010-EPW ENGINEERING- PUBLIC WALK 11/10/2022BF _____ AM 001-FIN FINAL INSPECTION 20221018 3127 MATLOCK DR 651 11/04/2022 Comments1: SOLAR -- GIO 813-860-3368 OR 813-861-491 Comments2: 9 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 24DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 24TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BF _____ AM 002-FEL FINAL ELECTRIC 11/04/2022 Comments1: SOLARGH _____ 002-FIN FINAL INSPECTION 20221038 4045 BRADY ST 11/30/2022 Comments1: FENCEPBF _____ AM 009-ESW ENGINEERING - SEWER / WAT 20221048 596 ALDER CT 42 11/03/2022 Comments1: WINNINGER 630-699-5148JP _____ AM 010-STP STOOP 11/14/2022 Comments1: MIDWESTERN 815-839-8175BC _____ AM 007-GAR GARAGE FLOOR 20221085 632 TIMBER OAK LN 46 11/14/2022 Comments1: MIDWESTERN 815-839-8175BC _____ AM 008-STP STOOP 11/14/2022 Comments1: MIDWESTERN 815-839-8175GH _____ 002-FIN FINAL INSPECTION 20221095 2056 SQUIRE CIR 189 11/30/2022 Comments1: FENCEGH _____ 002-FIN FINAL INSPECTION 20221103 4022 SHOEGER CT 32 11/30/2022 Comments1: FENCEBC _____ 003-FIN FINAL INSPECTION 20221114 4878 W MILLBROOK CIR 4 11/01/2022 Comments1: DECK -- CHRIS 630-330-8038JP _____ 005-FIN FINAL INSPECTION 20221118 4509 WINCHESTER LN A-D 11/14/2022 Comments1: JOSE 630-465-7459JP _____ 005-FIN FINAL INSPECTION 20221120 4512 WINCHESTER LN A-D 11/14/2022 Comments1: ROOFJP 11:00 001-PHF POST HOLE - FENCE 20221125 1072 SPRING ST 81 11/09/2022 Comments1: DON 630-774-9234GH _____ 010-RFR ROUGH FRAMING 20221132 3092 GRANDE TR 548 11/22/2022 Comments1: 331-223-6615 JIM/RYAN -- SEE INSPECTION Comments2: REPORTGH _____ 011-REL ROUGH ELECTRICAL 11/22/2022 Comments1: 331-223-6615 JIM/RYANGH _____ 012-RMC ROUGH MECHANICAL 11/22/2022 Comments1: 331-223-6615 JIM/RYANPBF _____ 013-PLR PLUMBING - ROUGH 11/22/2022 Comments1: 331-223-6615 JIM/RYAN -- SEE INSPECTION Comments2: REPORT DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 25DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 25TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ 014-INS INSULATION 01/28/2022 Comments1: 331-223-6615 JIM/RYAN -- SEE INSPECTION Comments2: REPORTSPR _____ 015-REI REINSPECTION 11/23/2022 Comments1: PLUMBING--ROUGH JIM 331-223-6615PBF _____ 005-PLU PLUMBING - UNDERSLAB 20221141 2088 COUNTRY HILLS DR 450 11/07/2022 Comments1: JEFF 847-456-8082GH _____ AM 006-BSM BASEMENT FLOOR 11/08/2022 Comments1: JUAN 847-551-9066GH _____ AM 007-GAR GARAGE FLOOR 11/08/2022BC _____ 008-GPL GREEN PLATE INSPECTION 11/16/2022 Comments1: 847-456-8082 JEFF/LENNARBF _____ PM 001-FIN FINAL INSPECTION 20221149 3108 REHBEHN CT 649 11/07/2022 Comments1: SOLAR 813-860-3866 EXCEL HOME SOLAR/GEOBF _____ PM 002-FEL FINAL ELECTRIC 11/07/2022 Comments1: SOLAR 813-860-3866 EXCEL HOME SOLAR/GEO* Comments2: ***DO NOT SCHEDULE REI UNTIL REI FEE IS Comments3: PAID*****BF _____ AM 003-REI REINSPECTION 11/17/2022 Comments1: FINAL SOLAR -- CHASE 573-453-8389 --**** Comments2: **PLEASE CALL WHEN ON WAY*******BF _____ AM 004-REI REINSPECTION 11/17/2022 Comments1: FINAL ELECTRICPR _____ AM 001-RFR ROUGH FRAMING 20221154 2075 MARKETVIEW DR 11/01/2022 Comments1: JOHN 630-973-9651PR _____ AM 002-REL ROUGH ELECTRICAL 11/01/2022PR _____ AM 003-PLR PLUMBING - ROUGH 11/01/2022BF _____ AM 001-FIN FINAL INSPECTION 20221162 2679 LILAC WAY 319 11/23/2022 Comments1: SOLAR -- RYAN 630-437-0553BF _____ AM 002-FEL FINAL ELECTRIC 11/23/2022 Comments1: SOLARJP _____ AM 008-STP STOOP 20221175 291 BARRETT DR A 13-3 11/01/2022 Comments1: JOSE 630-465-1159 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 26DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 26TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------JP _____ AM 008-STP STOOP 20221176 291 BARRETT DR B 13 11/01/2022 Comments1: JOSE 630-465-1159JP _____ AM 008-STP STOOP 20221177 291 BARRETT DR C 13 11/01/2022 Comments1: JOSE 630-465-1159JP _____ AM 008-STP STOOP 20221178 291 BARRETT DR D 13 11/01/2022 Comments1: JOSE 630-465-1159JP _____ 008-STP STOOP 20221179 271 BARRETT DR A 12 11/01/2022 Comments1: JOSE 630-465-1159JP _____ AM 008-STP STOOP 20221180 271 BARRETT DR B 12 11/01/2022 Comments1: JOSE 630-465-1159JP _____ AM 008-STP STOOP 20221181 271 BARRETT DR C 12 11/01/2022 Comments1: JOSE 630-465-1159JP _____ AM 008-STP STOOP 20221182 271 BARRETT DR D 12 11/01/2022 Comments1: JOSE 630-465-1159JP 11:00 001-PHF POST HOLE - FENCE 20221191 2038 SQUIRE CIR 194 11/10/2022 Comments1: CARLA -- 815-460-3449GH _____ 002-FIN FINAL INSPECTION 11/30/2022 Comments1: FENCEBC _____ AM 005-INS INSULATION 20221193 1091 BLACKBERRY SHORE LN 43 11/03/2022 Comments1: CARLOS 630-405-4131PR _____ AM 001-RFR ROUGH FRAMING 20221195 3159 JUSTICE DR 696 11/17/2022 Comments1: 847-363-4770 KIRK/MATRIXPR _____ AM 002-REL ROUGH ELECTRICAL 11/17/2022 Comments1: 847-363-4770 KIRK/MATRIXPR _____ AM 003-PLR PLUMBING - ROUGH 11/17/2022 Comments1: 847-363-4770 KIRK/MATRIXBC _____ AM 004-INS INSULATION 11/23/2022 Comments1: KIRK 847-363-4770BF _____ PM 005-FIN FINAL INSPECTION 20221196 2209 MEADOWVIEW LN 58 11/04/2022 Comments1: SOLAR 312-824-9031 LOGAN/SUNPOWERBF _____ PM 006-FEL FINAL ELECTRIC 11/04/2022 Comments1: SOLAR 312-824-9031 LOGAN/SUNPOWER DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 27DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 27TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------JP 13:00 001-PHF POST HOLE - FENCE 20221197 1318 WILLOW WAY 189 11/02/2022 Comments1: CLASSIC 630-551-3400GH _____ PM 001-FTG FOOTING 20221202 3056 GRANDE TR 541 11/22/2022 Comments1: MIDWESTERN 815-839-8175BC _____ PM 002-FOU FOUNDATION 11/23/2022 Comments1: MIDWESTERN 815-839-8175PR _____ PM 003-WAT WATER 11/30/2022 Comments1: 630-492-7635 AL'S FAMILY PLUMBBC _____ AM 001-FTG FOOTING 20221203 3029 MCLELLAN BLVD 559 11/09/2022 Comments1: MIDWESTERN 815-839-8175BC _____ PM 002-FOU FOUNDATION 11/10/2022 Comments1: MIDWESTERN 815-839-8175GH _____ AM 003-BKF BACKFILL 11/15/2022 Comments1: MIDWESTERN 815-839-8175PBF _____ PM 004-WAT WATER 11/16/2022 Comments1: 630-492-7635 AL'SJP _____ PM 005-GPL GREEN PLATE INSPECTION 11/29/2022 Comments1: JIM 331-223-6615JP 10:00 007-ROF ROOF UNDERLAYMENT ICE & W 20221207 2286 CRYDER CT 437 11/14/2022 Comments1: CARMELLA 630-364-0224JP _____ AM 008-PHD POST HOLE - DECK 11/22/2022 Comments1: CARMELLA 630-364-0224PR _____ 009-RFR ROUGH FRAMING 11/23/2022 Comments1: 630-364-0224 CLEAN EDGEPR _____ 010-REL ROUGH ELECTRICAL 11/23/2022 Comments1: 630-364-0224 CLEAN EDGEPR _____ 011-PLR PLUMBING - ROUGH 11/23/2022 Comments1: 630-364-0224 CLEAN EDGEPR _____ 012-RMC ROUGH MECHANICAL 11/23/2022 Comments1: 630-364-0224 CLEAN EDGEPR _____ AM 013-INS INSULATION 11/28/2022 Comments1: CARMELLA 630-364-0224 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 28DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 28TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BF _____ AM 001-FIN FINAL INSPECTION 20221210 1504 CORAL DR 175 11/14/2022 Comments1: SOLAR - SAM 331-442-9476BF _____ AM 002-FEL FINAL ELECTRIC 11/14/2022 Comments1: *****TO PAY REI FEES BEFORE RESCHEDULING Comments2: INSPECTION****PBF _____ 005-PLU PLUMBING - UNDERSLAB 20221219 2781 BERRYWOOD LN 792 11/01/2022 Comments1: CHRIS 224-358-1606GH _____ 006-GPL GREEN PLATE INSPECTION 11/17/2022 Comments1: CHRIS 224-358-1606 SEE INSPECTION REPOR Comments2: TPBF _____ 005-PLU PLUMBING - UNDERSLAB 20221220 2780 BERRYWOOD LN 833 11/03/2022 Comments1: CHRIS 224-358-1606GH _____ 006-PPS PRE-POUR, SLAB ON GRADE 11/15/2022 Comments1: SLAB -- CHRIS 224-358-1606 SEE INPECTION Comments2: REPORTGH _____ 007-GAR GARAGE FLOOR 11/15/2022PBF _____ 005-PLU PLUMBING - UNDERSLAB 20221221 2776 BERRYWOOD LN 834 11/03/2022 Comments1: CHRIS 224-358-1606GH _____ 006-PPS PRE-POUR, SLAB ON GRADE 11/15/2022 Comments1: SLAB -- CHRIS 224-358-1606 SEE INPECTION Comments2: REPORTGH _____ 007-GAR GARAGE FLOOR 11/15/2022PBF _____ 005-PLU PLUMBING - UNDERSLAB 20221222 2777 BERRYWOOD LN 791 11/01/2022 Comments1: CHRIS 224-358-1606BC _____ 006-GPL GREEN PLATE INSPECTION 11/23/2022 Comments1: MIKE 224-340-5860PBF _____ 006-PLU PLUMBING - UNDERSLAB 20221224 3111 GRANDE TR 493 11/03/2022 Comments1: JIM -- 331-223-6615JP _____ 007-GPL GREEN PLATE INSPECTION 11/04/2022 Comments1: JIM 331-223-6615GH _____ PM 008-BSM BASEMENT FLOOR 11/03/2022 Comments1: MIDWESTERN 815-839-8175GH _____ PM 009-GAR GARAGE FLOOR 11/03/2022 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 29DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 29TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ PM 010-STP STOOP 11/03/2022JP 13:00 001-PHF POST HOLE - FENCE 20221243 2805 BERRYWOOD LN 798 11/15/2022 Comments1: CARLA 815-460-3449GH _____ 002-FIN FINAL INSPECTION 11/30/2022 Comments1: FENCEBC _____ 004-REI REINSPECTION 20221247 2259 FAIRFIELD AVE 371 11/02/2022 Comments1: REI FRAMING ROBERT 815-579-9204BC _____ 005-PHD POST HOLE - DECK 11/04/2022 Comments1: ROBERT 815-579-9204BC _____ AM 003-BKF BACKFILL 20221249 3078 GRANDE TR 545 11/03/2022 Comments1: MIDWESTERN 815-839-8175PBF _____ PM 004-WAT WATER 11/07/2022 Comments1: AL'S 630-492-7635PBF _____ AM 005-WAT WATER 11/08/2022 Comments1: 630-492-7635 AL'S/LOUISEPBF _____ 006-PLU PLUMBING - UNDERSLAB 11/10/2022 Comments1: JIM -- 331-223-6615GH _____ 007-GPL GREEN PLATE INSPECTION 11/14/2022 Comments1: JIM 331-223-6615 -- SEE INSPECTION REPOR Comments2: TGH _____ PM 008-BSM BASEMENT FLOOR 11/18/2022 Comments1: MIDWESTERN 815-839-8175 -- SEE INSPECTIO Comments2: N REPORTBC _____ PM 001-FTG FOOTING 20221250 3024 GRANDE TR 536 11/15/2022 Comments1: 3:00PM MIDWESTERN 815-839-8175BC _____ PM 002-FOU FOUNDATION 11/17/2022 Comments1: MIDWESTERN 815-839-8175PBF _____ PM 003-WAT WATER 11/22/2022 Comments1: PM PLEASE -- ALS 630-492-7635GH _____ 004-BKF BACKFILL 11/22/2022 Comments1: MIDWESTERN 815-839-8175JP 14:00 001-PHF POST HOLE - FENCE 20221252 628 DENISE CT 36 11/15/2022 Comments1: CLASSIC 630-551-3400 cancel DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 30DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 30TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------JP 14:00 002-PHF POST HOLE - FENCE 11/16/2022 Comments1: 630-551-3400 CLASSICBC 13:00 001-FTG FOOTING 20221259 221 W VETERANS PKWY 11/10/2022 Comments1: CLEARANCE POLE FOOTING 630-770-9862 TACO Comments2: BELL KFC ARTUROGH _____ 001-PHF POST HOLE - FENCE 20221268 1264 HAWK HOLLOW DR 270 11/23/2022BF _____ AM 001-FIN FINAL INSPECTION 20221270 3063 GRANDE TR 556 11/10/2022 Comments1: SOLAR 801-837-4586 SUNRUN/EDDIEBF _____ AM 002-FEL FINAL ELECTRIC 11/10/2022 Comments1: SOLAR 801-837-4586 SUNRUN/EDDIEBF _____ AM 003-REI REINSPECTION 11/22/2022 Comments1: SOLAR ELECTRIC 801-837-4586 EDDIEJP _____ 005-FIN FINAL INSPECTION 20221275 4555 CAMDEN LN A-D 11/01/2022 Comments1: ROOF ---- JOSE 630-465-7459JP _____ 005-FIN FINAL INSPECTION 20221276 4528 GARRITANO ST A-D 11/01/2022 Comments1: JOSE 630-465-7459JP 12:00 001-ROF ROOF UNDERLAYMENT ICE & W 20221278 4576 CAMDEN LN A-D 11/02/2022 Comments1: JOSE 630-465-7459JP 12:00 002-ROF ROOF UNDERLAYMENT ICE & W 11/03/2022 Comments1: JOSE 630-465-7459JP _____ 003-FIN FINAL INSPECTION 11/14/2022 Comments1: ROOF -- JOSE 630-465-7459JP _____ 005-FIN FINAL INSPECTION 20221279 4565 CAMDEN LN A-D 11/14/2022 Comments1: ROOF -- JOSE 630-465-7459GH _____ 001-FIN FINAL INSPECTION 20221283 3963 SHOEGER DR 34 11/30/2022 Comments1: TEMP FENCE INSTALLED, PERMANENT FENCE BE Comments2: ING INSTALLED IN SPRING 2023 PER OWNERGH 12:00 001-PHF POST HOLE - FENCE 20221286 525 W BARBERRY CIR 0 11/23/2022 Comments1: RJ -- 630-674-2078JP 13:00 001-PHF POST HOLE - FENCE 20221288 2182 FAIRFAX WAY 510 11/02/2022 Comments1: CARLA 815-460-3449 -- SEE INSPECTION REP Comments2: ORTBC _____ AM 002-RFR ROUGH FRAMING 20221291 3020 MCLELLAN BLVD 528 11/01/2022 Comments1: ANDY 630-514-9062 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 31DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 31TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BC _____ PM 003-FIN FINAL INSPECTION 11/15/2022 Comments1: DECK 630-514-9062 ANDYBC _____ PM 002-FOU FOUNDATION 20221292 1091 AUBURN DR 93 11/02/2022 Comments1: RANDY 630-816-8023BC _____ PM 003-BKF BACKFILL 11/09/2022 Comments1: DAVE 630-878-5792 -- BRACE WALLS BEFORE Comments2: BACKFILLPR _____ 004-SEW SEWER INSPECTION 11/15/2022PR _____ 005-WAT WATER 11/15/2022 Comments1: 630-918-2348 MCCUE/BOBPR _____ PM 001-RFR ROUGH FRAMING 20221295 521 MANCHESTER LN 393 11/01/2022 Comments1: BASEMENT -- CARMELLA 630-364-0224PR _____ PM 002-REL ROUGH ELECTRICAL 11/01/2022PR _____ PM 003-RMC ROUGH MECHANICAL 11/01/2022PR _____ PM 004-PLR PLUMBING - ROUGH 11/01/2022BC 09:00 005-REI REINSPECTION 11/02/2022 Comments1: FIRE STOP -- CARMELLA 630-364-0224GH _____ 006-INS INSULATION 11/03/2022 Comments1: CARMELLA 630-364-0224JP 11:30 001-PHF POST HOLE - FENCE 20221297 1206 CANNONBALL TR 3 11/03/2022 Comments1: BONNIE 815-255-2132BF _____ AM 001-FIN FINAL INSPECTION 20221302 1447 ASPEN LN 105 11/03/2022 Comments1: SOLAR 331-701-6607 BRIAN/FREEDOM FOREVERBF _____ AM 002-FEL FINAL ELECTRIC 11/03/2022 Comments1: SOLAR 331-701-6607 BRIAN/FREEDOM FOREVERBF _____ PM 001-FIN FINAL INSPECTION 20221305 2008 SWITCHGRASS LN 131 11/02/2022 Comments1: SOLAR -- BEN 847-702-9907-- ******DO NOT Comments2: SCHEDULE REI UNTILL REI FEE IS RECEIVED Comments3: ****BF _____ PM 002-FEL FINAL ELECTRIC 11/02/2022BF _____ AM 003-REI REINSPECTION 11/29/2022 Comments1: SOLAR -- FINAL -- HAYTHEM 630-506-0399 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 32DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 32TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BF _____ AM 004-REI REINSPECTION 11/29/2022 Comments1: SOLAR ELECTRICBC _____ AM 001-FTG FOOTING 20221308 2670 SEELEY ST 735 11/14/2022 Comments1: JESUS 630-453-9281BC _____ AM 002-FOU FOUNDATION 11/23/2022 Comments1: JESUS 630-453-9281PBF _____ PM 003-WAT WATER 11/29/2022 Comments1: TERRI 847-975-2512BC _____ AM 001-FTG FOOTING 20221309 2674 SEELEY ST 734 11/14/2022 Comments1: JESUS 630-453-9281BC _____ AM 002-FOU FOUNDATION 11/23/2022 Comments1: JESUS 630-453-9281PBF _____ PM 003-WAT WATER 11/29/2022 Comments1: TERRI 847-975-2512BC _____ AM 001-FTG FOOTING 20221310 2678 SEELEY ST 733 11/14/2022 Comments1: JESUS 630-453-9281BC _____ AM 002-FOU FOUNDATION 11/23/2022 Comments1: JESUS 630-453-9281PBF _____ PM 003-WAT WATER 11/29/2022 Comments1: TERRI 847-975-2512BC _____ AM 001-FTG FOOTING 20221311 2682 SEELEY ST 732 11/14/2022 Comments1: JESUS 630-453-9281BC _____ AM 002-FOU FOUNDATION 11/21/2022 Comments1: JESUS 630-453-9281PBF _____ PM 003-WAT WATER 11/28/2022 Comments1: TERRI - HOLIDAY 847-975-2512BC _____ AM 001-FTG FOOTING 20221312 2686 SEELEY ST 731 11/14/2022 Comments1: JESUS 630-453-9281BC _____ AM 002-FOU FOUNDATION 11/21/2022 Comments1: JESUS 630-453-9281PBF _____ PM 003-WAT WATER 11/28/2022 Comments1: TERRI - HOLIDAY 847-975-2512 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 33DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 33TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------JP _____ 002-FIN FINAL INSPECTION 20221331 805 STATE ST 11/28/2022 Comments1: -- ALPHA 630-923-2285BC _____ AM 001-FTG FOOTING 20221333 2862 MCLELLAN BLVD 457 11/14/2022 Comments1: REMY 630-973-6699BC _____ AM 002-FOU FOUNDATION 11/23/2022 Comments1: REMY 630-882-9755GH _____ 002-FOU FOUNDATION 20221334 264A PORTAGE LN 123 11/18/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/21/2022 Comments1: ALS 630-492-7635GH _____ 002-FOU FOUNDATION 20221335 264B PORTAGE LN 122 11/18/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/21/2022 Comments1: ALS 630-492-7635GH _____ 002-FOU FOUNDATION 20221336 264C PORTAGE LN 121 11/18/2022 Comments1: JESUS 630-453-9281PR _____ AM 003-ESW ENGINEERING - SEWER / WAT 11/21/2022 Comments1: ALS 630-492-7635GH _____ AM 002-FOU FOUNDATION 20221337 264D PORTAGE LN 120 11/18/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/21/2022 Comments1: ALS 630-492-7635GH _____ AM 002-FOU FOUNDATION 20221338 276A PORTAGE LN 115 11/15/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/18/2022 Comments1: LOUISE - AL'S 630-492-7635GH _____ AM 002-FOU FOUNDATION 20221339 276B PORTAGE LN 116 11/15/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/18/2022 Comments1: LOUISE - AL'S 630-492-7635GH _____ AM 002-FOU FOUNDATION 20221340 276C PORTAGE LN 117 11/15/2022 Comments1: JESUS 630-453-9281 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 34DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 34TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/18/2022 Comments1: LOUISE - AL'S 630-492-7635GH _____ AM 002-FOU FOUNDATION 20221341 276D PORTAGE LN 118 11/15/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/18/2022 Comments1: LOUISE - AL'S 630-492-7635GH _____ AM 002-FOU FOUNDATION 20221342 276E PORTAGE LN 119 11/15/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/18/2022 Comments1: LOUISE - AL'S 630-492-7635GH _____ 002-FOU FOUNDATION 20221343 282A BARRETT DR 114 11/07/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/17/2022 Comments1: LOUISE - AL'S 630-492-7635GH _____ 002-FOU FOUNDATION 20221344 282B BARRETT DR 113 11/07/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/17/2022 Comments1: LOUISE - AL'S 630-492-7635GH _____ 002-FOU FOUNDATION 20221345 282C BARRETT DR 112 11/07/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/17/2022 Comments1: LOUISE - AL'S 630-492-7635GH _____ 002-FOU FOUNDATION 20221346 282D BARRETT DR 111 11/07/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/17/2022 Comments1: LOUISE - AL'S 630-492-7635GH _____ PM 002-FOU FOUNDATION 20221347 282E BARRETT DR 110 11/07/2022 Comments1: JESUS 630-453-9281PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/17/2022 Comments1: LOUISE - AL'S 630-492-7635GH _____ 002-FOU FOUNDATION 20221348 282F BARRETT DR 109 11/07/2022 Comments1: JESUS 630-453-9281 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 35DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 35TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------PR _____ PM 003-ESW ENGINEERING - SEWER / WAT 11/17/2022 Comments1: LOUISE - AL'S 630-492-7635BC _____ AM 001-FTG FOOTING 20221349 3762 BISSEL DR 129-5 11/04/2022 Comments1: JEFF 630-330-6705BC _____ AM 002-FOU FOUNDATION 11/21/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/23/2022 Comments1: TERRI - HOLIDAY 847-975-2512GH _____ 004-BKF BACKFILL 11/29/2022 Comments1: CHRIS 224-358-1606BC _____ AM 001-FTG FOOTING 20221350 3764 BISSEL DR 129-4 11/04/2022 Comments1: JEFF 630-330-6705BC _____ AM 002-FOU FOUNDATION 11/21/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/23/2022 Comments1: TERRI - HOLIDAY 847-975-2512GH _____ 004-BKF BACKFILL 11/29/2022 Comments1: CHRIS 224-358-1606BC _____ AM 001-FTG FOOTING 20221351 3766 BISSEL DR 129-3 11/04/2022 Comments1: JEFF 630-330-6705BC _____ AM 002-FOU FOUNDATION 11/21/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/23/2022 Comments1: TERRI - HOLIDAY 847-975-2512GH _____ 004-BKF BACKFILL 11/29/2022 Comments1: CHRIS 224-358-1606BC _____ AM 001-FTG FOOTING 20221352 3768 BISSEL DR 129-2 11/04/2022 Comments1: JEFF 630-330-6705BC _____ AM 002-FOU FOUNDATION 11/21/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/23/2022 Comments1: TERRI - HOLIDAY 847-975-2512 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 36DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 36TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ 004-BKF BACKFILL 11/29/2022 Comments1: CHRIS 224-358-1606BC _____ AM 001-FTG FOOTING 20221353 3772 BISSEL DR 129-1 11/04/2022 Comments1: JEFF 630-330-6705BC _____ AM 002-FOU FOUNDATION 11/21/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/23/2022 Comments1: TERRI - HOLIDAY 847-975-2512GH _____ 004-BKF BACKFILL 11/29/2022 Comments1: CHRIS 224-358-1606BC _____ AM 001-FTG FOOTING 20221354 3748 BISSEL DR 130-1 11/04/2022 Comments1: JEFF -- 630-330-6705BC _____ AM 002-FOU FOUNDATION 11/10/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/17/2022 Comments1: R=TERRI -- 847-975-2512GH _____ 004-BKF BACKFILL 11/18/2022PBF _____ 005-PLU PLUMBING - UNDERSLAB 11/23/2022 Comments1: MIKE 224-340-5860BC _____ 006-PPS PRE-POUR, SLAB ON GRADE 11/28/2022BC _____ AM 001-FTG FOOTING 20221355 3752 BISSEL DR 130-2 11/04/2022 Comments1: JEFF 630-330-6705BC _____ AM 002-FOU FOUNDATION 11/10/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/17/2022 Comments1: TERRI 847-975-2512GH _____ 004-BKF BACKFILL 11/18/2022PBF _____ 005-PLU PLUMBING - UNDERSLAB 11/23/2022 Comments1: MIKE 224-340-5860BC _____ 006-PPS PRE-POUR, SLAB ON GRADE 11/28/2022BC _____ AM 003-FTG FOOTING 20221356 3754 BISSEL DR 130-3 11/04/2022 Comments1: JEFF 630-330-6705 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 37DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 37TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BC _____ AM 004-FOU FOUNDATION 11/10/2022 Comments1: JEFF 630-330-6705PBF _____ PM 005-WAT WATER 11/17/2022 Comments1: TERRI - 847-975-2512GH _____ 006-BKF BACKFILL 11/18/2022PBF _____ 007-PLU PLUMBING - UNDERSLAB 11/23/2022 Comments1: MIKE 224-340-5860BC _____ 008-PPS PRE-POUR, SLAB ON GRADE 11/28/2022BC _____ AM 001-FTG FOOTING 20221357 3756 BISSEL DR 130-4 11/04/2022 Comments1: JEFF 630-330-6705BC _____ AM 002-FOU FOUNDATION 11/10/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/17/2022 Comments1: TERRI - 847-975-2512GH _____ 004-BKF BACKFILL 11/18/2022PBF _____ 005-PLU PLUMBING - UNDERSLAB 11/23/2022 Comments1: MIKE 224-340-5860BC _____ 006-PPS PRE-POUR, SLAB ON GRADE 11/28/2022PBF _____ PM 001-WAT WATER 20221358 3758 BISSEL DR 130-5 11/17/2022 Comments1: TERRI - 847-975-2512BC _____ 002-FTG FOOTING 11/10/2022BC _____ 003-FOU FOUNDATION 11/10/2022GH _____ 004-BKF BACKFILL 11/18/2022PBF _____ 005-PLU PLUMBING - UNDERSLAB 11/23/2022 Comments1: MIKE 224-340-5860BC _____ 006-PPS PRE-POUR, SLAB ON GRADE 11/28/2022GH _____ 002-FOU FOUNDATION 20221359 3798 BISSEL DR 127-1 11/02/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/15/2022 Comments1: TERRI 847-975-2512 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 38DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 38TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ 004-BKF BACKFILL 11/18/2022GH _____ 002-FOU FOUNDATION 20221360 3796 BISSEL DR 127-2 11/02/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/15/2022 Comments1: TERRI 847-975-2512GH _____ 004-BKF BACKFILL 11/18/2022GH _____ 002-FOU FOUNDATION 20221361 3794 BISSEL DR 127-3 11/02/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/15/2022 Comments1: TERRI 847-975-2512GH _____ 004-BKF BACKFILL 11/18/2022GH _____ 002-FOU FOUNDATION 20221362 3792 BISSEL DR 127-4 11/02/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/15/2022 Comments1: TERRI 847-975-2512GH _____ 004-BKF BACKFILL 11/18/2022GH _____ 002-FOU FOUNDATION 20221363 3788 BISSEL DR 127-5 11/02/2022 Comments1: JEFF 630-330-6705PBF _____ PM 003-WAT WATER 11/15/2022 Comments1: TERRI 847-975-2512GH _____ 004-BKF BACKFILL 11/18/2022BC _____ 001-FTG FOOTING 20221364 3776 BISSEL DR 128 11/01/2022 Comments1: JEFF 630-330-6705BC _____ AM 002-FOU FOUNDATION 11/04/2022 Comments1: JEFF 630-330-6705PBF _____ AM 003-WAT WATER 11/18/2022 Comments1: TERRI - 847-975-2512 - SEE INSPECTION RE Comments2: PORTGH _____ 004-BKF BACKFILL 11/18/2022BC _____ 001-FTG FOOTING 20221365 3778 BISSEL DR 128-2 11/01/2022 Comments1: JEFF 630-330-6705 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 39DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 39TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------BC _____ AM 002-FOU FOUNDATION 11/04/2022 Comments1: JEFF 630-330-6705PBF _____ AM 003-WAT WATER 11/18/2022 Comments1: TERRI -847-975-2512 -- SEE INSPECTION RE Comments2: PORTGH _____ 004-BKF BACKFILL 11/18/2022BC _____ 001-FTG FOOTING 20221366 3782 BISSEL DR 128-3 11/01/2022 Comments1: JEFF 630-330-6705BC _____ AM 002-FOU FOUNDATION 11/04/2022 Comments1: JEFF 630-330-6705PBF _____ AM 003-WAT WATER 11/18/2022 Comments1: TERRI 847-975-2512 SEE INSPECTION REPORTGH _____ 004-BKF BACKFILL 11/18/2022BC _____ 001-FTG FOOTING 20221367 3784 BISSEL DR 128-4 11/01/2022 Comments1: JEFF 630-330-6705BC _____ AM 002-FOU FOUNDATION 11/04/2022 Comments1: JEFF 630-330-6705PBF _____ AM 003-WAT WATER 11/18/2022 Comments1: TERRI 847-975-2512 - SEE INSPECTION REPO Comments2: RTGH _____ 004-BKF BACKFILL 11/18/2022PBF _____ AM 001-WAT WATER 20221368 3786 BISSEL DR 128-5 11/18/2022 Comments1: TERRI 847-975-2512 -- SEE INSPECTION REP Comments2: ORTGH _____ 002-BKF BACKFILL 11/18/2022GH 12:00 001-ROF ROOF UNDERLAYMENT ICE & W 20221373 110 CONOVER CT 13 11/03/2022 Comments1: JUSTIN 331-203-3914 SEE INSPECTION REPOR Comments2: TJP 14:00 001-PHF POST HOLE - FENCE 20221374 353 PENSACOLA ST 1145 11/04/2022 Comments1: MONICA 630-327-7066JP _____ 002-FIN FINAL INSPECTION 11/14/2022 Comments1: FENCE -- MONICA 630-327-7066 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 40DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 40TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ AM 001-FTG FOOTING 20221377 224A PORTAGE LN 140 11/17/2022 Comments1: JESUS 630-453-9281GH _____ AM 002-FOU FOUNDATION 11/28/2022 Comments1: JESUS 630-453-9281GH _____ AM 001-FTG FOOTING 20221378 224B PORTAGE LN 141 11/17/2022 Comments1: JESUS 630-453-9281GH _____ AM 002-FOU FOUNDATION 11/28/2022 Comments1: JESUS 630-453-9281GH _____ AM 001-FTG FOOTING 20221379 224C PORTAGE LN 142 11/17/2022 Comments1: JESUS 630-453-9281GH _____ AM 002-FOU FOUNDATION 11/28/2022 Comments1: JESUS 630-453-9281GH _____ AM 001-FTG FOOTING 20221380 224D PORTAGE LN 143 11/17/2022 Comments1: JESUS 630-453-9281GH _____ AM 002-FOU FOUNDATION 11/28/2022 Comments1: JESUS 630-453-9281GH _____ AM 001-FTG FOOTING 20221381 236A PORTAGE LN 135 11/17/2022 Comments1: JESUS 630-453-9281GH _____ AM 002-FOU FOUNDATION 11/22/2022 Comments1: JESUS 630-453-9281GH _____ AM 001-FTG FOOTING 20221382 236B PORTAGE LN 136 11/17/2022 Comments1: JESUS 630-453-9281GH _____ AM 002-FOU FOUNDATION 11/22/2022 Comments1: JESUS 630-453-9281GH _____ AM 001-FTG FOOTING 20221383 236C PORTAGE LN 137 11/17/2022 Comments1: JESUS 630-453-9281GH _____ AM 002-FOU FOUNDATION 11/22/2022 Comments1: JESUS 630-453-9281GH _____ AM 001-FTG FOOTING 20221384 236D PORTAGE LN 138 11/17/2022 Comments1: JESUS 630-453-9281GH _____ AM 002-FOU FOUNDATION 11/22/2022GH _____ AM 001-FTG FOOTING 20221385 236E PORTAGE LN 139 11/17/2022 Comments1: JESUS 630-453-9281 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 41DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 41TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------GH _____ AM 002-FOU FOUNDATION 11/22/2022 Comments1: JESUS 630-453-9281BC _____ AM 002-RFR ROUGH FRAMING 20221390 206 E WASHINGTON ST 11/09/2022 Comments1: ANDREA -- 815-690-3907 -- SEE INSPECTION Comments2: REPORTBC _____ PM 003-REI REINSPECTION 11/18/2022 Comments1: ANDREA -- 815-690-3907 , PLEASE CALL WHE Comments2: N EN ROUTEJP 09:00 001-PHD POST HOLE - DECK 20221391 628 WHITE OAK WAY 59 11/28/2022 Comments1: 630-553-1773 SEE INSPECTION REPORTBC _____ AM 001-WKS PUBLIC & SERVICE WALKS 20221393 8710 RT 71 11/09/2022 Comments1: JORDAN 630-450-4679JP 12:00 002-ROF ROOF UNDERLAYMENT ICE & W 20221394 4575 CAMDEN LN A-D 11/01/2022 Comments1: JOSE 630-465-7459 NORTH END AND PORCHES Comments2: LEFT FOR NEXT DAYJP _____ 003-FIN FINAL INSPECTION 11/14/2022 Comments1: ROOF -- JOSE 630-465-7459JP 11:30 001-PHF POST HOLE - FENCE 20221395 3022 GRANDE TR 535 11/02/2022 Comments1: PERLA 708-316-9740JP 09:00 001-ROF ROOF UNDERLAYMENT ICE & W 20221400 4656 PLYMOUTH AVE 11/15/2022 Comments1: CANCELJP 12:00 002-ROF ROOF UNDERLAYMENT ICE & W 11/21/2022 Comments1: EDGAR 224-587-6429JP _____ 002-FIN FINAL INSPECTION 20221404 306 W MAIN ST 11/03/2022 Comments1: ROOF -- DANNY 630-518-6040JP _____ 001-ROF ROOF UNDERLAYMENT ICE & W 20221406 707 S BRIDGE ST 11/01/2022JP _____ 002-FIN FINAL INSPECTION 11/21/2022 Comments1: MISSING SEVERAL PIECES OF DRIP EDGE - RE Comments2: QUIRES SUFFICIENT VENTINGPR _____ AM 001-RFR ROUGH FRAMING 20221408 1587 SIENNA DR 84 11/14/2022 Comments1: CARMELLA 630-364-0224PR _____ AM 002-REL ROUGH ELECTRICAL 11/14/2022PR _____ 003-RMC ROUGH MECHANICAL 11/14/2022 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 42DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 42TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------PR _____ AM 004-PLR PLUMBING - ROUGH 11/14/2022JP 11:00 001-PHF POST HOLE - FENCE 20221416 1448 ASPEN LN 129 11/15/2022 Comments1: MARIA 630-809-4166JP 12:00 001-ROF ROOF UNDERLAYMENT ICE & W 20221420 1221 EVERGREEN LN 11/03/2022 Comments1: MARCUS 630-248-0918JP 12:00 001-ROF ROOF UNDERLAYMENT ICE & W 20221421 4592 GARRITANO LN A-E 11/03/2022 Comments1: JOSE 630-465-7459JP 12:00 002-ROF ROOF UNDERLAYMENT ICE & W 11/03/2022 Comments1: JOSE 630-465-7459 - PARTIALJP 12:00 003-ROF ROOF UNDERLAYMENT ICE & W 11/07/2022 Comments1: JOSE 630-465-7459 - PARTIALJP 12:00 004-ROF ROOF UNDERLAYMENT ICE & W 11/08/2022 Comments1: JOSE 630-465-7459JP _____ 005-FIN FINAL INSPECTION 11/18/2022 Comments1: ROOF 630-465-7459JP 11:00 001-ROF ROOF UNDERLAYMENT ICE & W 20221425 411 E BARBERRY CIR 155 11/09/2022 Comments1: NEW HORIZON 224-587-6429 EDGARJP 11:00 001-ROF ROOF UNDERLAYMENT ICE & W 20221426 361 TIMBALIER ST 1016 11/22/2022 Comments1: EDGAR 224-587-6429JP 12:00 001-ROF ROOF UNDERLAYMENT ICE & W 20221427 4671 PLYMOUTH AVE 1025 11/15/2022 Comments1: CANCELJP 10:00 002-ROF ROOF UNDERLAYMENT ICE & W 11/21/2022 Comments1: EDGAR 224-587-6429JP 11:00 001-ROF ROOF UNDERLAYMENT ICE & W 20221430 4657 PLYMOUTH AVE 1023 11/10/2022 Comments1: EDGAR 224-587-6429 - PHOTOS NEEDEDJP 10:30 001-ROF ROOF UNDERLAYMENT ICE & W 20221434 2539 EMERALD LN 125 11/09/2022JP _____ 002-FIN FINAL INSPECTION 11/14/2022 Comments1: ROOF -PR _____ AM 001-ESW ENGINEERING - SEWER / WAT 20221455 805 FREEMONT ST 44 11/15/2022 Comments1: LATE AM -- JOHN 630-546-8057BC _____ AM 002-FTG FOOTING 11/22/2022 Comments1: LATE MORNING, EARLY AFTERNOON. JOHN 630- Comments2: 546-8057 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 43DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 43TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------JP 11:30 001-PHF POST HOLE - FENCE 20221461 2362 WINTERTHUR GREEN 182 11/21/2022 Comments1: 708-316-9740 PERLA/ILL FENCEBC _____ AM 001-FTG FOOTING 20221464 1934 CONEFLOWER CT 147 11/09/2022 Comments1: DECK 630-514-2267 BOB/RLKBC _____ 002-RFR ROUGH FRAMING 11/15/2022 Comments1: SEE INSPECTION REPORTJP 13:00 001-PHF POST HOLE - FENCE 20221467 2221 COUNTRY HILLS DR 469 11/29/2022 Comments1: PERLA 708-316-9740GH _____ AM 001-PPS PRE-POUR, SLAB ON GRADE 20221469 15 CANNONBALL TR 11/23/2022 Comments1: LOUIS 331-300-9061BC _____ AM 001-RFR ROUGH FRAMING 20221478 2259 FAIRFIELD AVE 371 11/29/2022 Comments1: DECK --- ROBERT 815-579-9204GH 11:00 001-ROF ROOF UNDERLAYMENT ICE & W 20221483 406 W RIDGE ST 11/23/2022 Comments1: JEFF 331-203-3914JP 09:30 001-PHF POST HOLE - FENCE 20221485 832 BLUESTEM DR 115 11/29/2022 Comments1: SHERRIE 815-836-8731GH 11:00 001-ROF ROOF UNDERLAYMENT ICE & W 20221502 824 HOMESTEAD DR 20 11/23/2022 Comments1: LOUIS 773-474-1413JP _____ 002-FIN FINAL INSPECTION 11/29/2022 Comments1: ROOF -- LOUIS 773-474-1413 -- SEE INSPEC Comments2: TION REPORTJP _____ 001-FIN FINAL INSPECTION 20221513 307 ILLINI DR 11/30/2022 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 44DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 44TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------PERMIT TYPE SUMMARY: ADD ADDITION 9 BSM BASEMENT REMODEL 15 COM COMMERCIAL BUILDING 2 CON CONCRETE PAD 1 CRM COMMERCIAL REMODEL 9 DCK DECK 16 ESN ELECTRIC SIGN 2 FNC FENCE 30 FOU FOUNDATION 1 MSC MISCELLANEOUS 4 REM REMODEL 1 REP REPAIR 4 ROF ROOFING 37 SFA SINGLE-FAMILY ATTACHED 211 SFD SINGLE-FAMILY DETACHED 354 SHD SHED/ACCESSORY BUILDING 2 SOL SOLAR PANELS 27 WIN WINDOW REPLACEMENT 1INSPECTION SUMMARY: ABC ABOVE CEILING 1 ADA ADA ACCESSIBLE WALK WAY 7 BKF BACKFILL 27 BSM BASEMENT FLOOR 5 EDA ENGINEERING - DRIVEWAY APRON 4 EFL ENGINEERING - FINAL INSPECTION 44 ELE ELECTRIC SERVICE 1 ELU ELECTRICAL - UNDERSLAB 1 EPW ENGINEERING- PUBLIC WALK 22 ESW ENGINEERING - SEWER / WATER 18 FEL FINAL ELECTRIC 36 FIN FINAL INSPECTION 72 FMC FINAL MECHANICAL 24 FME FINAL MECHANICAL 2 FOU FOUNDATION 56 FTG FOOTING 40 GAR GARAGE FLOOR 8 GPL GREEN PLATE INSPECTION 10 INS INSULATION 24 MIS MISCELLANEOUS 1 PHD POST HOLE - DECK 6 PHF POST HOLE - FENCE 20 PLF PLUMBING - FINAL OSR READY 27 PLR PLUMBING - ROUGH 25 PLU PLUMBING - UNDERSLAB 16 PPS PRE-POUR, SLAB ON GRADE 13 REI REINSPECTION 30 REL ROUGH ELECTRICAL 27 DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 45DATE: 12/01/2022 UNITED CITY OF YORKVILLE PAGE: 45TIME: 07:53:44 CALLS FOR INSPECTION REPORTID: PT4A0000.WOW INSPECTIONS SCHEDULED FROM 11/01/2022 TO 11/30/2022INSPECTOR SCHED. COMP. TIME TYPE OF INSPECTION PERMIT ADDRESS LOT DATE DATE------------------------------------------------------------------------------------------------------------------------------------ RFR ROUGH FRAMING 32 RMC ROUGH MECHANICAL 24 ROF ROOF UNDERLAYMENT ICE & WATER 22 SEW SEWER INSPECTION 1 STP STOOP 21 SUM SUMP 8 WAT WATER 36 WK SERVICE WALK 14 WKS PUBLIC & SERVICE WALKS 1INSPECTOR SUMMARY: BC BOB CREADEUR 154 BF B&F INSPECTOR CODE SERVICE 25 ED ERIC DHUSE 59 GH GINA HASTINGS 210 JP JOHN PETRAGALLO 108 PBF BF PLUMBING INSPECTOR 99 PR PETER RATOS 71STATUS SUMMARY: A PR 3 C BC 24 C ED 45 C GH 62 C JP 26 C PBF 24 C PR 8 E ED 1 I BC 130 I BF 25 I ED 9 I GH 148 I JP 82 I PBF 75 I PR 60 T ED 4REPORT SUMMARY: 726 Have a question or comment about this agenda item? Call us Monday-Friday, 8:00am to 4:30pm at 630-553-4350, email us at agendas@yorkville.il.us, post at www.facebook.com/CityofYorkville, tweet us at @CityofYorkville, and/or contact any of your elected officials at http://www.yorkville.il.us/320/City-Council Agenda Item Summary Memo Title: Meeting and Date: Synopsis: Council Action Previously Taken: Date of Action: Action Taken: Item Number: Type of Vote Required: Council Action Requested: Submitted by: Agenda Item Notes: Reviewed By: Legal Finance Engineer City Administrator Community Development Purchasing Police Public Works Parks and Recreation Agenda Item Number New Business #3 Tracking Number EDC 2023-03 Property Maintenance Reports for November 2022 Economic Development Committee – January 3, 2023 Informational None Pete Ratos Community Development Name Department Page | 1 Property Maintenance Report November 2022 There was 1 case heard in November 2022. 11/14/22 N 3707 212 Windham Circle Weeds Dismissed Memorandum To: Economic Development Committee From: Pete Ratos, Code Official CC: Bart Olson, Krysti Barksdale-Noble, Jori Behland Date November 29, 2022 Subject: November Property Maintenance Case # Case Date TYPE OF VIOLATIONSTATUS VIOLATION LETTER SENTFOLLOW UP STATUSCITATION ISSUEDDATE OF HEARINGPOSTED FINDINGS PUBLIC WORKS TO MOW20220386 11/29/2022 Commencing Work Without PermitCLOSED COMPLIANT20220385 11/21/2022 Vacant Structures/LandCLOSED COMPLIANT20220384 11/18/2022 Parking on Unapproved SurfaceIN VIOLATION 11/18/2022 11/30/2022 1/4/202320220383 11/18/2022 Commencing Work Without PermitCLOSED COMPLIANT20220382 11/17/2022 Obstruction of Public WayCLOSED COMPLIANT20220381 11/9/2022 Grass/Weeds Height/Fence MaintenanceCLOSED COMPLIANT20220380 11/9/2022 Commencing Work Without PermitIN VIOLATION 11/15/2022 11/28/2022 1/4/202320220379 11/9/2022 Construction DebrisCLOSED COMPLIANT20220378 11/3/2022 Sign General ProvisionsCLOSED COMPLIANT20220377 11/2/2022 Sign General ProvisionsCLOSED COMPLIANT20220376 11/1/2022 Sign General ProvisionsCLOSED COMPLIANTCase Report11/1/2022 - 11/30/2022ADDRESS OF COMPLAINT307 Illini Dr301 Jackson St451 Honeysuckle3020 Mclellan Blvd3000 Mclellan Blvd2282 High Ridge LnTotal Records: 1111/30/20221131 Blackberry Shore Ln3300 Seeley St3100 Cannon Ball Trl400 Block Jefferson StRt 47 and Rt 34 Public Page: 1 of 1 Have a question or comment about this agenda item? Call us Monday-Friday, 8:00am to 4:30pm at 630-553-4350, email us at agendas@yorkville.il.us, post at www.facebook.com/CityofYorkville, tweet us at @CityofYorkville, and/or contact any of your elected officials at http://www.yorkville.il.us/320/City-Council Agenda Item Summary Memo Title: Meeting and Date: Synopsis: Council Action Previously Taken: Date of Action: Action Taken: Item Number: Type of Vote Required: Council Action Requested: Submitted by: Agenda Item Notes: Reviewed By: Legal Finance Engineer City Administrator Community Development Purchasing Police Public Works Parks and Recreation Agenda Item Number New Business #4 Tracking Number EDC 2023-04 Economic Development Report for December 2022 Economic Development Committee – January 3, 2023 Informational None An update will be given at the meeting. Bart Olson Administration Name Department Have a question or comment about this agenda item? Call us Monday-Friday, 8:00am to 4:30pm at 630-553-4350, email us at agendas@yorkville.il.us, post at www.facebook.com/CityofYorkville, tweet us at @CityofYorkville, and/or contact any of your elected officials at http://www.yorkville.il.us/320/City-Council Agenda Item Summary Memo Title: Meeting and Date: Synopsis: Council Action Previously Taken: Date of Action: Action Taken: Item Number: Type of Vote Required: Council Action Requested: Submitted by: Agenda Item Notes: See attached memo. Reviewed By: Legal Finance Engineer City Administrator Purchasing Manager Community Development Police Public Works Parks and Recreation Agenda Item Number New Business #5 Tracking Number EDC 2023-05 New Leaf Energy – Solar Farm (Annex, Rezone and Special Use) Economic Development Committee – January 3, 2023 Majority Approval Requested Annexation, Rezoning and Special Use approval for a proposed freestanding solar energy system (FSES) or “solar farm”. Krysti Barksdale – Noble, AICP Community Development Name Department BACKGROUND AND PROJECT DESCRIPTION: The applicant, C. Dean Smith on behalf of New Leaf Energy dba Beecher Solar 1, LLC, contract leasee, is requesting annexation, rezoning, and special use permit approval to construct a 5-megawatt (MW) alternating current (AC) freestanding community solar farm. As part of the request, the petitioner is seeking to annex approximately 48 acres of unincorporated agricultural land consisting of three (3) parcels #02-18- 400-005, #02-18-400-006, and #02-17-300-002. The proposed solar farm will be situated on approximately 18.44 acres of the existing farmland parcel located immediately north of the BNSF railroad line and east of Beecher Road. The petitioner is seeking rezoning upon annexation from the City’s default R-1 Single Family Suburban Residential zoning to the A-1 Agricultural zoning district. Memorandum To: Economic Development Committee From: Krysti Barksdale-Noble, Community Development Director CC: Bart Olson, City Administrator Jason Engberg, Senior Planner Date: December 29, 2022 Subject: PZC 2022-24 New Leaf Energy – Solar Farm Annexation, Rezoning and Special Use ANNEXATION REQUEST: As mentioned, the applicant seeks annexation of three (3) unincorporated parcels, #02-18-400-005, #02-18-400-006, and #02-17-300-002, totaling approximately 48-acres for the purpose of constructing and operating a community solar farm on approximately 19 acres of the annexed area. Annexation is contingent upon City Council approval of a requested rezoning to A-1 Agricultural District and special use authorization for the solar farm. A draft annexation agreement has been provided for review and comment. Staff recommends a Plat of Annexation be provided as an exhibit to the annexation agreement. A public hearing for the proposed annexation is set for January 24, 2023 before the City Council. REZONING REQUEST: Per Section 10-5-5: Zoning of Annexed Land of the United City of Yorkville’s Zoning Ordinance states, “Any territory or land hereafter annexed to the City shall automatically, upon such annexation, be classified within the R-1 residential district and be subject to all conditions and regulations applicable to land in such district until such land is subsequently rezoned”. Therefore, the petitioner is seeking rezoning within the A-1 Agricultural District. This zoning classification would permit the continued farm use on the remainder of the annexed land. SPECIAL USE REQUEST: Per Table 10.06.07 Alternative Energy Uses of the United City of Yorkville’s Zoning Ordinance, solar farms are authorized special uses only in the A-1 Agricultural District, OS-1 Open Space (Passive), OS-2 (Active) and O-Office District. Simultaneously with the rezoning request, the applicant is seeking special use authorization. The subject property is currently located in unincorporated Kendall County. The following are the current immediate surrounding zoning and land uses: Zoning Land Use North A-1 Special Use (Kendall County) Agriculture (Special Use approved for sanitary landfill in 1963) South A-1 Special Use (Kendall County) Agriculture/ BNSF Railroad East R-2 Single-Family Traditional Residence District Whispering Meadows Subdivision West M-2 General Manufacturing District Lincoln Prairie (South) Beecher Road Location on Site Table 10.07.01 of Chapter 7 in the City’s Zoning Ordinance provides dimensions and bulk regulations for the A-1 Agricultural District. The following compares the yard setbacks required for the A-1 Agricultural District and the proposed solar farm use: Minimum Requirement Proposed Setback Front (West) 100 feet 150 feet (fence)/183 feet (solar array) Rear (East) None 157 feet (solar array) Side (North) 50 feet 50 feet (solar array) Side (South) 50 feet 91 feet (solar array) x Staff has identified the west property line (adjacent to Beecher Road) as the front property line, per Section 10-2-3: Definitions of the United City of Yorkville’s Zoning ordinance which establishes the lot line which abuts a street shall be the front lot line. The proposed community solar farm will consist of approximately 9,700 arrays totaling about 36,500 linear feet of racking. The system will include two (2) inverters and two (2) transformers with four (4) tracker motors. The petitioner will enter a twenty (20) year lease with the property owner to operate the proposed community solar farm. The lese also has an option to extend the lease term for up to four (4) additional and successive periods of five (5) years each. ALTERNATIVE ENERGY SYSTEMS REGULATIONS: Chapter 19: Alternative Energy Systems of the Zoning Ordinance identifies freestanding solar energy systems (FSES) as a special use within all zoning districts and establishes regulations which were used in the review of this request. The following describes how the proposed plan meets the regulations for Freestanding Solar Energy Systems: Height The maximum structure height in the A-1 Agricultural District is eighty (80) feet. Additionally, as stated in Section 10-19-7-D of the City’s Zoning Ordinance, the minimum clearance between the lowest point of the system and the surface which the system is mounted is ten (10) feet. Section 10-19-7-F states the maximum height will be stipulated as a special use condition. The petitioner has submitted an exhibit illustrating that the maximum solar array height, including trackers/racking/string inverters, is 94 inches (approx. 8 feet) at maximum tilt. Additionally, the petitioner proposes a minimum solar array clearance as 32 inches (approximately 2.6 feet). Note the solar array clearance is less than the minimum required ten (10) feet. Staff has encountered this issue with previous solar field proposals, and we are aware of the current industry standards for height is consistent with the petitioner’s request. It is our intention to revise this section of the Alternative Energy Systems regulations as part of the upcoming Unified Development Ordinance (UDO) to meet current best practices. Therefore, staff is not opposed to the required minimum clearance proposed. Distance from Residential Properties In addition to meeting the required minimum setbacks, the proposed solar farm transformer will be 790 feet south from the property line of the nearest unincorporated residence located on Beecher Road. Further, the overall solar farm project area is approximately 2,280 feet from the nearest residentially platted Yorkville property in the Whispering Meadows subdivision. Glare Per Section 10-19-7-E of the Zoning Ordinance regarding Alternative Energy Systems for freestanding solar units, the panels are to be placed such that the concentrated solar radiation or glare does is not directed onto nearby properties or roadways. The panels shall be placed to face east and rotate west to follow the path of the sun to collect the most sunlight throughout the day. The petitioner has provided a Forgesolar Glare Analysis of four (4) observation points where glare could potentially be seen emitting from the PV arrays as either “green glare” of “yellow glare”. Green glare is defined as a glare with low potential to cause an after image (flash blindness) when observed prior to a typical blink response time. While yellow glare is a glare with a higher potential to cause an after image when observed prior to a typical blink response. According to the analysis summary, none of the four (4) observation points produced a yellow or green glare at any time during the day light hours. Additionally, the petitioner also states one (1) motion-sensor security light will be provided at each of the two (2) transformer areas. The proposed light standard will be between 7 feet – 9 feet in overall height. Staff defers to the City Engineer, who recommends a photometric plan will need to be provided as part of the final engineering plans. Fencing The petitioner has proposed a seven (7) foot security galvanized chain link fence to surround the perimeter of the solar farm. As stated in Section 10-17-2-G, Fence Regulations for Industrial Districts of the Zoning Ordinance, states that a fence may be a maximum of eight (8) feet in height. This section of the code also states that chain link is a permitted material. The fencing will include a gated main entry with a total of ten (10) 4-foot gates and one (1) 20-foot gate for vehicle access. Staff recommends a Knox box and keys shall be provided to the City’s building department and Bristol Kendall Fire District (BKFD). The petitioner has agreed to this recommendation. Noise Per the petitioner’s project summary, the transformer is the greatest source of noise on the property. As proposed, the transformer is approximately 790 feet south of the nearest residence located on Beecher Road. At 500 feet, the noise generated by each transformer is 21 decibels. Noise levels measured at the property line will not exceed fifty (50) decibels. Accessory Use Section 10-19-4-D states that alternative energy systems shall be an accessory to the principal permitted use. The proposed solar farm will be accessory to the existing agricultural/farming land use, as only portion of the overall land is proposed for the community solar farm use (approx.18.44 acres of 48 acres or 38%). Signage Section 10-19-4-F states that no commercial signage or attention getting device is permitted on any alternative energy system, but one (1) sign shall be permitted to indicate emergency contact information of the property owner or operator not to exceed two (2) square feet in area. The petitioner has resubmitted plans that now indicates contact information signage will be located on the solar farm’s fence (refer to fence detail located on image above). Utilities and Electric Service Provider The proposed community solar farm will not require public utilities such as water or sanitary sewer. The routing of the electrical infrastructure required to connect to the ComEd system appears to include an overhead wire connection near the entrance of Beecher Road. Section 10-19-4-G states that evidence that the electric utility service provider that serves the proposed site has been notified of the owner’s intent to install an interconnected customer owned electricity generator. The petitioner has provided a copy of an Interconnection Agreement, as prepared by ComEd dated 06/07/2022. Access Road The proposed site access is via a new 20-ft. wide gravel driveway proposed off Beecher Road. The path provides access to the equipment, however, no formal parking stalls are provided, as no buildings, employees are planned on the site except for the occasional mowing or maintenance visits, about 3-4 times per year. Gravel roads are not permitted for vehicle travel; however, staff notes the road will have the top 4” CA-6 compacted, the next 8” CA-1 compacted with a compacted subgrade. Staff feels this is sufficient based upon the limited amount of vehicular traffic and restricted access to the site. Landscape Plan While perimeter landscaping is not required for solar farm uses, the petitioner indicates landscaping material (trees along eastern and southern boundaries) on the site plan. The petitioner does note in the project narrative that “post-construction site area will be seeded with a low-mow seed mix and a weed/grass control plan.” Staff recommends a landscape plan be submitted as part of the final engineering submittal, per comments from the City Engineer. Abandoned Systems In the Zoning Ordinance, Section 10-19-4-E states all alternative energy systems inactive or inoperable for a period of 12 continuous months shall be deemed abandoned and the owner is required to repair or remove the system from the property at the owner’s expense within 90 days of notice from the City. To ensure compliance, the petitioner has provided a decommission plan and construction estimate of $283,078.11 at year 25 with a 2% annual inflation rate. The City Engineer has reviewed the estimate and recommends the annual inflation rate be increased. Therefore, staff recommends a security guarantee in this amount and in a form acceptable to the City Engineer as a condition of the Special Use approval. In addition to the security guarantee, staff also recommends a blanket easement over the property to allow the City or its contractor to enter and remove the abandoned system in compliance with the City Code, as a condition of the Special Use approval. The petitioner is aware of these conditions which will be a part of their special use authorization. Special Use Standards Section 10-19-4-C and 10-4-9-F state specific standards for special use which all recommendation bodies will review. The petitioner has provided answers to each of the criteria in the application as well as providing an additional attachment to these standards which are included in the packet for your review and will be entered into the public record as part of the public hearing process. ENGINEERING COMMENTS: Please refer to the attached comments prepared by Engineering Enterprises Inc. (EEI) dated November 29, 2022. The work items listed in the review letter will become conditions for the Special Use and a requirement for issuance of a building permit. STAFF COMMENTS: This request is tentatively scheduled for a public hearing at the January 24, 2023 City Council meeting for the annexation agreement and a public hearing before the Planning and Zoning Commission on February 8, 2023 for rezoning and special use consideration. Staff and the petitioner are seeking comments from the Economic Development Committee about the proposed solar farm before these public hearings. ATTACHMENTS: 1. Annexation Agreement Application 2. Rezoning Application 3. Special Use Application 4. New Leaf Energy Project Narrative with Attachments 5. Plan Council Packet (12-08-2022) 6. New Leaf Energy Supplemental Materials 7. Draft Annexation Agreement APPLICATION FOR ANNEXATION United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fa x: 630-553-7575 Website: www.yorkville.il.us INTENT AND PURPOSE The purpose of this application is to allow unincorporated land that is contiguous and adjacent to the Yorkville corporate limits WRDQQH[LQWRWKH&LW\$OOQHZO\DQQH[HGODQGLVDXWRPDWLFDOO\]RQHGWRWKHPRVWUHVWULFWLYHFODVVLÀFDWLRQXQGHUWKHFLW\·V]RQLQJ RUGLQDQFH 56LQJOH)DPLO\6XEXUEDQ5HVLGHQFH'LVWULFW 7KHUHIRUHDOOYROXQWDU\DQQH[DWLRQSHWLWLRQVZKLFKDUHVHHNLQJDGLHUHQW ]RQLQJFODVVLÀFDWLRQZLOOKDYHWRDGKHUHWRWKHUH]RQLQJSURFHVVRXWOLQHGLQ´7LWOH&KDSWHU6HFWLRQ$PHQGPHQWVµ This packet explains the process to successfully submit and complete an Application for Annexation. It includes a detailed description of the process, outlines required submittal materials, and contains the application. )RUDFRPSOHWHH[SODQDWLRQRIZKDWLVOHJDOO\UHTXLUHGWKURXJKRXWWKHSURFHVVSOHDVHUHIHUWR´7LWOH&KDSWHU6HFWLRQ $QQH[DWLRQVµRIWKH<RUNYLOOH,OOLQRLV&LW\&RGH APPLICATION PROCEDURE STEP1 APPLICATION SUBMITTAL SUBMIT APPLICATION, FEES, AND PLANS TO THE COMMUNITY DEVELOPMENT DEPT. The following must be submitted: One (1) original signed and notarized application. Legal description of the property in Microsoft Word. Three (3) copies each of the exhibits, proposed drawings, location map, and site plan. All exhibits and plans must be an appropriate size for all details and descriptions to be legible. $SSURSULDWHDSSOLFDWLRQDQGÀOLQJIHH&KHFNVPD\EHZULWWHQWRWKH8QLWHG&LW\RI<RUNYLOOH Signed Applicant Deposit Account/Acknowledgment of Financial Responsibility form. One (1) electronic copy (PDF) of all materials submitted including application and exhibits. Within one (1) week of submittal, the Community Development Department will determine if the application is complete or if additional information is needed. An incomplete submittal could delay the scheduling of the project. The petitioner is responsible for payment of recording fees and public hearing costs, including written transcripts of the public hearing and outside consultant costs (i.e. legal review, land planner, zoning coordinator, environmental, etc.). The petitioner will be required to establish a deposit account with the City to cover these fees. 2QFHDVXEPLWWHGDQGFRPSOHWH&RPPXQLW\'HYHORSPHQWVWDZLOOSURYLGHDWHQWDWLYHVFKHGXOHRI meetings as well as all needed documents for the process. The petitioner must present the proposed request to the Plan Council. The members of the Council LQFOXGH WKH &RPPXQLW\ 'HYHORSPHQW 'LUHFWRU &LW\ (QJLQHHU WKH%XLOGLQJ 'HSDUWPHQW 2FLDO WKH Public Works Director, the Director of Parks and Recreation, a Fire Department Representative, and a Police Department Representative. This meeting is held to provide the petitioner with guidance from DOO&LW\VWDGHSDUWPHQWVWRHQVXUHWKHSHWLWLRQHULVDZDUHRIDOOUHTXLUHPHQWVDQGUHJXODWLRQVIRUWKHLU GHYHORSPHQW8SRQUHFRPPHQGDWLRQE\WKH3ODQ&RXQFLOWKHSHWLWLRQHUZLOOPRYHIRUZDUGWRWKH Economic Development Committee. STEP2 PLAN COUNCIL MEETS ON THE 2ND & 4TH THURSDAY OF THE MONTH 7KLVVWHSLVGHSHQGHQWRQWKHFRPSOH[LW\RIUHTXHVWVDQGPD\EHVNLSSHGDWWKHGLVFUHWLRQRIVWDଉ APPLICATION FOR ANNEXATION United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fa x: 630-553-7575 Website: www.yorkville.il.us The petitioner must present the proposed plan to the Economic Development Committee. The committee consists of four alderman who will provide feedback to the petitioner regarding their request. This feedback allows the petitioner to gather comments and concerns prior to full City Council considerations. It also allows the City Council members to review the request prior to its arrival at City Council. STEP3 ECONOMIC DEVELOPMENT COMMITTEE MEETS ON THE 1ST TUESDAY OF THE MONTH ,IWKHUHLVQRWDUHTXHVWIRUUH]RQLQJRU38'DJUHHPHQWWKHQWKHUHTXHVWZLOOJRGLUHFWO\WRWKH&LW\ Council for a public hearing. The petitioner will attend and present their request at a public hearing conducted by the City Council. The City Council will conduct a public hearing on the request, take public comments, and discuss the request. 7KHSHWLWLRQHULVUHVSRQVLEOHIRUVHQGLQJFHUWLÀHGSXEOLFKHDULQJQRWLFHVWRDGMDFHQWSURSHUW\RZQHUV ZLWKLQÀYHKXQGUHG IHHWRIWKHVXEMHFWSURSHUW\QROHVVWKDQÀIWHHQ GD\VDQGQRPRUHWKDQWKLUW\ GD\VSULRUWRWKHSXEOLFKHDULQJGDWH7KHSXEOLFKHDULQJQRWLFHZLOOEHGUDIWHGE\WKH&LW\DVZHOODV published in a local newspaper. Additionally, a public hearing notice sign must be placed on the property QROHVVWKDQÀIWHHQ GD\VSULRUWRWKHSXEOLFKHDULQJ $ FHUWLÀHG DGDYLW PXVW EH ÀOHG E\ WKH SHWLWLRQHU ZLWK WKH &RPPXQLW\ 'HYHORSPHQW 'HSDUWPHQW FRQWDLQLQJWKHQDPHVDGGUHVVHVDQGSHUPDQHQWSDUFHOQXPEHUVRIDOOSDUWLHVWKDWZHUHQRWLÀHG7KH &HUWLÀHG0DLOLQJ$GDYLWIRUPLVDWWDFKHGWRWKLVGRFXPHQW STEP4 CITY COUNCIL PUBLIC HEARING MEETS ON THE 2ND & 4TH TUESDAY OF THE MONTH STEP5 CITY COUNCIL MEETS ON THE 2ND & 4TH TUESDAY OF THE MONTH The petitioner will attend the City Council meeting where the annexation request will be reviewed. Depending on the complexity of the request this meeting may be held at the same meeting of the public KHDULQJ,IDSSURYHG&LW\VWDZLOOKDYHDGUDIWHGRUGLQDQFHWREHVLJQHGE\WKH&RXQFLODQGPXVWEH recorded with the County Clerk before any further steps may be taken by the petitioner. NECESSARY NOTIFICATIONS 7KHHQWLWLHVOLVWHGEHORZPXVWEHQRWLÀHGLQZULWLQJE\FHUWLÀHGRUUHJLVWHUHGPDLORIWKHSURSRVHGDQQH[DWLRQVDWOHDVWWHQ days prior to the action taken at City Council. Notices must be delivered to the individual board members at their respective home addresses: 7UXVWHHVRIWKHÀUHSURWHFWLRQGLVWULFW Trustees of the public library district Township Highway Commissioner, Township Trustees, Township Supervisor, and Township Clerk if land to be annexed includes any highway under township jurisdiction APPLICATION FOR ANNEXATION United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fa x: 630-553-7575 Website: www.yorkville.il.us DORMANT APPLICATIONS The Community Development Director shall determine if an application meets or fails to meet the submission requirements. If the Director determines that the application is incomplete it will become dormant under these circumstances: •7KHDSSOLFDQWKDVEHHQQRWLÀHGRIVXFKGHÀFLHQFLHVDQGKDVQRWUHVSRQGHGRUSURYLGHGDWLPHOLQHIRUFRPSOHWLQJWKH DSSOLFDWLRQZLWKLQQLQHW\ GD\VIURPWKHWLPHRIQRWLÀFDWLRQ • The applicant has not responded in writing to a request for information or documentation from the initial planning and zoning commission review within six (6) months from the date of that request. • The applicant has not responded to a request for legal or engineering deposit replenishment for city incurred costs and fees ZLWKLQQLQHW\ GD\VIURPWKHGDWHRIWKHUHTXHVW If the Community Development Director has sent the required notice and the applicant has not withdrawn their application or brought it into compliance, then the director shall terminate the application. After termination, the application shall not be UHFRQVLGHUHGH[FHSWDIWHUWKHÀOLQJRIDFRPSOHWHO\QHZDSSOLFDWLRQ :LWKGUDZDORUWHUPLQDWLRQRIDQDSSOLFDWLRQVKDOOQRWDHFWWKHDSSOLFDQW·VUHVSRQVLELOLW\IRUSD\PHQWRIDQ\FRVWVDQGIHHVRUDQ\ other outstanding debt owed to the city. The balance of any funds deposited with the city that is not needed to pay for costs and IHHVVKDOOEHUHWXUQHGWRWKHDSSOLFDQW 2UG SAMPLE MEETING SCHEDULE MONTH 1 MONTH 2 MONTH 3 Su M Tu W Th F Sa 12 3456789 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 Su M Tu W Th F Sa 1234567 8 9 1011121314 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 Su M Tu W Th F Sa 12345 6789101112 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 City Council Public HearingEconomic Development CommitteePlan Council Meeting This is a sample of what a schedule may look like after submission. The Step 1 Submission must be completed before the Plan Council Meeting can be scheduled. This timeline represents an ideal schedule. Throughout the review process, there may be requests or changes to the submission requested by the committees which may delay the meeting schedule. As illustrated, there is a small amount of time between meeting dates and the deadline for updated materials to be submitted for review. Depending RQWKHFRPSOH[LW\DQGQDWXUHRIWKHUHTXHVWWKLVWLPHOLQHPD\EHH[WHQGHGWRJLYHWKHSHWLWLRQHUDQGVWDHQRXJKWLPHWRUHYLHZ requested updates to the submission. Public Notice Mailing WindowMeeting Date Updated Materials Submitted for Meeting APPLICATION FOR ANNEXATION United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fa x: 630-553-7575 Website: www.yorkville.il.us INVOICE & WORKSHEET PETITION APPLICATION CONCEPT PLAN REVIEW Engineering Plan Review deposit $500.00 Total: $ AMENDMENT Annexation Plan Plat P.U.D. $500.00 $500.00 $500.00 $500.00 Total: $ ANNEXATION $250.00 + $10 per acre for each acre over 5 acres Total: $ ____________ - 5 = ____________ x $10 = ____________ + $250 = $ ____________ # of Acres Acres over 5 Amount for Extra Acres Total Amount REZONING $200.00 + $10 per acre for each acre over 5 acres Total: $ If annexing and rezoning, charge only 1 per acre fee; if rezoning to a PUD, charge PUD Development Fee - not Rezoning Fee ____________ - 5 = ____________ x $10 = ____________ + $200 = $ ____________ # of Acres Acres over 5 Amount for Extra Acres Total Amount SPECIAL USE $250.00 + $10 per acre for each acre over 5 acres Total: $ ____________ - 5 = ____________ x $10 = ____________ + $250 = $ ____________ # of Acres Acres over 5 Amount for Extra Acres Total Amount ZONING VARIANCE $85.00 + $500.00 outside consultants deposit Total: $ PRELIMINARY PLAN FEE $500.00 Total: $ PUD FEE $500.00 Total: $ FINAL PLAT FEE $500.00 Total: $ ENGINEERING PLAN REVIEW DEPOSIT Less than 1 acre Over 1 acre, less than 10 acres Over 10 acres, less than 40 acres Over 40 acres, less than 100 acres Over 100 acres $5,000.00 $10,000.00 $15,000.00 $20,000.00 $25,000.00 Total: $ OUTSIDE CONSULTANTS DEPOSIT Legal, land planner, zoning coordinator, environmental services Total: $ For Annexation, Subdivision, Rezoning, and Special Use: Less than 2 acres Over 2 acres, less than 10 acres Over 10 acres $1,000.00 $2,500.00 $5,000.00 TOTAL AMOUNT DUE: ✔ 25 20 200 450 450 ✔ 400 25 20 200 400 ✔ 25 20 200 450 450 ✔ 5000 ✔ 5000 11300 APPLICATION FOR ANNEXATION United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fa x: 630-553-7575 Website: www.yorkville.il.us DATE: PZC NUMBER: DEVELOPMENT NAME: PETITIONER INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: BUSINESS HOME EMAIL: FAX: PROPERTY INFORMATION NAME OF HOLDER OF LEGAL TITLE: IS THE PROPERTY OCCUPIED OR VACANT: IF OCCUPIED, PLEASE LIST ALL NAMES OF ELECTORS (THOSE REGISTERED TO VOTE) RESIDING ON THE PROPERTY: IF LEGAL TITLE IS HELD BY A LAND TRUST, LIST THE NAMES OF ALL HOLDERS OF ANY BENEFICIAL INTEREST THEREIN: PROPERTY STREET ADDRESS: DESCRIPTION OF PROPERTY’S PHYSICAL LOCATION: CURRENT ZONING CLASSIFICATION: ZONING AND LAND USE OF SURROUNDING PROPERTIES NORTH: EAST: SOUTH: WEST: KENDALL COUNTY PARCEL IDENTIFICATION NUMBER(S) 11/1/2022 Beecher Road Beecher Solar 1, LLC New Leaf Energy Inc. 55 Technology Dr Suite #102 Lowell, MA, 01851 978-221-3103 dsmith@newleafenergy.com ● Robert M. and Ildefonsa Loftus Occupied Robert M. and Ildefonsa Loftus Robert M. and Ildefonsa Loftus Beecher Road, Yorkville, IL 60401 An existing farmland located at parcels 02-18-400-005, 02-18-400-006, and 02-17-300-002, east of Beecher Road in Yorkville, IL. A-1 A-1 A-1 A-1 A-1 02-18-400-005 02-18-400-006 02-17-300-002 APPLICATION FOR ANNEXATION United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fa x: 630-553-7575 Website: www.yorkville.il.us PLEASE DESCRIBE IN DETAIL ANY ADDITIONAL REQUESTS TO BE MADE UPON ANNEXATION APPROVAL. ATTORNEY INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: ENGINEER INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: LAND PLANNER/SURVEYOR INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: ATTACHMENTS Petitioner must attach a legal description of the property to this application and title it as “Exhibit A”. Petitioner must list the names and addresses of any adjoining or contiguous landowners within five hundred (500) feet of the property that are entitled notice of application under any applicable City Ordinance or State Statute. Attach a separate list to this application and title it as “Exhibit B”. Petitioner must provide a written petition signed by a majority of the owners of record of land in the territory and also by a majority of the electors, if any, residing in the territory. Attach as a separate petition titled as “Exhibit C”. Michael Massie Massie & Quick, LLC 115 NW 3rd Ave, PO Box 205 Galva, IL, 61436 309-932-2168 mike@massielaw.net Tony Puljic New Leaf Energy Inc. 55 Technology Dr Suite #102 Lowell, MA, 01851 773-406-9565 tpuljic@newleafenergy.com Marisa Kolman Greenberg Farrow 21 South Evergreen Avenue Suite 200 Arlington Heights, IL, 60005 847-788-9200 mkolman@greenbergfarrow.com APPLICANT DEPOSIT ACCOUNT/ ACKNOWLEDGMENT OF FINANCIAL RESPONSIBILITY United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us PRINT NAME SIGNATURE* TITLE DATE PROJECT NUMBER: FUND ACCOUNT NUMBER: PROPERTY ADDRESS: PETITIONER DEPOSIT ACCOUNT FUND: It is the policy of the United City of Yorkville to require any petitioner seeking approval on a project or entitlement request to establish a Petitioner Deposit Account Fund to cover all actual expenses occurred as a result of processing such applications and requests. Typical requests requiring the establishment of a Petitioner Deposit Account Fund include, but are not limited to, plan review of development approvals/engineering permits. Deposit account funds may also be used to cover costs for services related to legal fees, engineering and other plan reviews, processing of other governmental applications, recording fees and other outside coordination and consulting fees. Each fund account is established with an initial deposit based upon the estimated cost for services provided in the INVOICE & WORKSHEET PETITION APPLICATION. This initial deposit is drawn against to pay for these services related to the project or request. Periodically throughout the project review/approval process, the Financially Responsible Party will receive an invoice reflecting the charges made against the account. At any time the balance of the fund account fall below ten percent (10%) of the original deposit amount, the Financially Responsible Party will receive an invoice requesting additional funds equal to one-hundred percent (100%) of the initial deposit if subsequent reviews/fees related to the project are required. In the event that a deposit account is not immediately replenished, review by the administrative staff, consultants, boards and commissions may be suspended until the account is fully replenished. If additional funds remain in the deposit account at the completion of the project, the city will refund the balance to the Financially Responsible Party. A written request must be submitted by the Financially Responsible Party to the city by the 15th of the month in order for the refund check to be processed and distributed by the 15th of the following month. All refund checks will be made payable to the Financially Responsible Party and mailed to the address provided when the account was established. ACKNOWLEDGMENT OF FINANCIAL RESPONSIBILITY NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: FINANCIALLY RESPONSIBLE PARTY: I acknowledge and understand that as the Financially Responsible Party, expenses may exceed the estimated initial deposit and, when requested by the United City of Yorkville, I will provide additional funds to maintain the required account balance. Further, the sale or other disposition of the property does not relieve the individual or Company/Corporation of their obligation to maintain a positive balance in the fund account, unless the United City of Yorkville approves a Change of Responsible Party and transfer of funds. Should the account go into deficit, all City work may stop until the requested replenishment deposit is received. *The name of the individual and the person who signs this declaration must be the same. If a corporation is listed, a corporate officer must sign the declaration (President, Vice- President, Chairman, Secretary or Treasurer) INITIAL ENGINEERING/LEGAL DEPOSIT TOTALS ENGINEERING DEPOSITS: Up to one (1) acre Over one (1) acre, but less than ten (10) acres Over ten (10) acres, but less than forty (40) acres Over forty (40) acres, but less than one hundred (100) In excess of one hundred (100.00) acres $5,000 $10,000 $15,000 $20,000 $25,000 LEGAL DEPOSITS: Less than two (2) acres Over two (2) acres, but less than ten (10) acres Over ten (10) acres $1,000 $2,500 $5,000 Beecher Solar 1, LLC By 1115 Solar Development, LLC, its sole member and manager Beecher Road, Yorkville, IL 60401 Brendan Neagle New Leaf Energy Inc. 55 Technology Dr Suite #102 Lowell, MA, 01851 978-513-2613 bneagle@newleafenergy.com Brendan Neagle EVP Project Finance CERTIFIED MAILING AFFIDAVIT STATE OF ILLINOIS ) ) SS COUNTY OF KENDALL ) I/We, ________________________, petitioner, being first duly sworn, do hereby state under oath that to the best of my knowledge the attached list is a true, correct and complete list of all permanent parcel numbers, and names and addresses of owners, of all lots and parts of lots located within 500 feet (exclusively of any public streets and alleys) of the property legally described on the attached application for annexation, rezoning, special use permit, planned unit development, variation, or other zoning amendment. I further state that said list was obtained from the current tax rolls of the Kendall County Treasurer’s Office. I further state that I mailed by U.S. Certified Mail, Return Receipt Requested, a copy of the Public Notice of Public Hearing before the United City of Yorkville Planning and Zoning Commission for the Public Hearing held on Wednesday, _______________, at the United City of City Council Chambers, Yorkville, Illinois. The notice was mailed to the attached list of all of the permanent parcel numbers and names and addresses of owners at the U.S. Post office on _______________________, 20_____. ________________________________ Signature of Petitioner(s) Subscribed and sworn to before me this ________ day of _______________, 20______ ______________________________________ Notary Public To be provided later PERMIT NUMBER: DATE/TIME RECEIVED: SITE ADDRESS: PARCEL NUMBER: SUBDIVISION: LOT/UNIT: APPLICANT INFORMATION NAME: TELEPHONE: HOME BUSINESS ADDRESS: E-MAIL: HOME BUSINESS CITY, STATE, ZIP: FAX: SIGN INFORMATION DATE OF PICK UP: NUMBER OF SIGNS: DATE OF PUBLIC HEARING: SIGN RETURN DATE: The undersigned hereby states that they have acquired Public Hearing Signs from the United City of Yorkville’s Community Development Department and agrees to return said sign/s to Yorkville City Hall, 800 Game Farm Road, Yorkville, Illinois, immediately following the date of the public hearing. Petitioner or Representative agrees to pay to the United City of Yorkville a deposit of $50 for each sign. The deposit will be returned to the petitioner when the public hearing sign/s have been returned to the City. Petitioner or Representative further agrees to pay to the United City of Yorkville the full amount of the purchase price for each sign not returned to the United City of Yorkville within seven (7) days after the date of the public hearing. ___________________________________________________________________________ __________________________________ SIGNATURE/AUTHORIZED AGENT DATE DATE RETURNED: _____________________________________________________ RECEIVED BY: _______________________________________________________ PZC# ______________________________ APPLICATION FOR PUBLIC HEARING SIGN 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us 02-18-400-005, 02-18-400-006, 02-17-300-002Beecher Road, Yorkville, IL 60401 Beecher Solar 1, LLC 55 Technology Dr Suite #102 Lowell, MA, 01851 978-221-3103 dsmith@newleafenergy.com 11/11/22 APPLICATION FOR REZONING United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us INTENT AND PURPOSE 5H]RQLQJLVDW\SHRIPDSDPHQGPHQWZKLFKDOORZVIRUWKHUHFODVVLÀFDWLRQRIDSURSHUW\·V]RQLQJGLVWULFW$UHTXHVWIRUUH]RQLQJ PXVWQRWEHDUELWUDU\7KHUHDUHVHYHUDOODQGXVHIDFWRUVZKLFKDUHFRQVLGHUHGGXULQJWKHUHYLHZSURFHVVIRUDUH]RQLQJUHTXHVW LQFOXGLQJWKHVXLWDELOLW\RIVXUURXQGLQJODQGXVHVDQG]RQLQJGLVWULFWVORFDOGHYHORSPHQWWUHQGVSRWHQWLDOWUDFLPSDFWVDQGWKH RYHUDOOSXEOLFKHDOWKDQGVDIHW\RIWKHFRPPXQLW\ 7KLVSDFNHWH[SODLQVWKHSURFHVVWRVXFFHVVIXOO\VXEPLWDQGFRPSOHWHDQ$SSOLFDWLRQIRU5H]RQLQJ,WLQFOXGHVDGHWDLOHGGHVFULSWLRQ RIWKHSURFHVVRXWOLQHVUHTXLUHGVXEPLWWDOPDWHULDOVDQGFRQWDLQVWKHDSSOLFDWLRQIRUUH]RQLQJ )RUDFRPSOHWHH[SODQDWLRQRIZKDWLVOHJDOO\UHTXLUHGWKURXJKRXWWKH6SHFLDO8VHSURFHVVSOHDVHUHIHUWR´7LWOH&KDSWHU 6HFWLRQ $PHQGPHQWVµRIWKH<RUNYLOOH,OOLQRLV&LW\&RGH APPLICATION PROCEDURE STEP1 APPLICATION SUBMITTAL SUBMIT APPLICATION, FEES, AND PLANS TO THE COMMUNITY DEVELOPMENT DEPT. 7KHIROORZLQJPXVWEHVXEPLWWHG 2QH RULJLQDOVLJQHGDQGQRWDUL]HGDSSOLFDWLRQ /HJDOGHVFULSWLRQRIWKHSURSHUW\LQ0LFURVRIW:RUG 7KUHH FRSLHVHDFKRIWKHH[KLELWVSURSRVHGGUDZLQJVORFDWLRQPDSDQGVLWHSODQ$OOH[KLELWV DQGSODQVPXVWEHDQDSSURSULDWHVL]HIRUDOOGHWDLOVDQGGHVFULSWLRQVWREHOHJLEOH $SSURSULDWHDSSOLFDWLRQDQGÀOLQJIHH&KHFNVPD\EHZULWWHQWRWKH8QLWHG&LW\RI<RUNYLOOH 6LJQHG$SSOLFDQW'HSRVLW$FFRXQW$FNQRZOHGJPHQWRI)LQDQFLDO5HVSRQVLELOLW\IRUP 2QH HOHFWURQLFFRS\ 3') RIDOOPDWHULDOVVXEPLWWHGLQFOXGLQJDSSOLFDWLRQDQGH[KLELWV :LWKLQ RQH ZHHN RI VXEPLWWDO WKH &RPPXQLW\ 'HYHORSPHQW 'HSDUWPHQW ZLOO GHWHUPLQH LI WKH DSSOLFDWLRQLVFRPSOHWHRULIDGGLWLRQDOLQIRUPDWLRQLVQHHGHG$QLQFRPSOHWHVXEPLWWDOFRXOGGHOD\WKH VFKHGXOLQJRIWKHSURMHFW 7KHSHWLWLRQHULVUHVSRQVLEOHIRUSD\PHQWRIUHFRUGLQJIHHVDQGSXEOLFKHDULQJFRVWVLQFOXGLQJZULWWHQ WUDQVFULSWVRIWKHSXEOLFKHDULQJDQGRXWVLGHFRQVXOWDQWFRVWV LHOHJDOUHYLHZODQGSODQQHU]RQLQJ FRRUGLQDWRUHQYLURQPHQWDOHWF 7KHSHWLWLRQHUZLOOEHUHTXLUHGWRHVWDEOLVKDGHSRVLWDFFRXQWZLWKWKH &LW\WRFRYHUWKHVHIHHV 2QFHDVXEPLWWHGDQGFRPSOHWH&RPPXQLW\'HYHORSPHQWVWDZLOOSURYLGHDWHQWDWLYHVFKHGXOHRI PHHWLQJVDVZHOODVDOOQHHGHGGRFXPHQWVIRUWKHSURFHVV 7KHSHWLWLRQHUPXVWSUHVHQWWKHSURSRVHGUHTXHVWWRWKH3ODQ&RXQFLO7KHPHPEHUVRIWKH&RXQFLO LQFOXGH WKH &RPPXQLW\ 'HYHORSPHQW 'LUHFWRU &LW\ (QJLQHHU WKH%XLOGLQJ 'HSDUWPHQW 2FLDO WKH 3XEOLF:RUNV'LUHFWRUWKH'LUHFWRURI3DUNVDQG5HFUHDWLRQD)LUH'HSDUWPHQW5HSUHVHQWDWLYHDQGD 3ROLFH'HSDUWPHQW5HSUHVHQWDWLYH7KLVPHHWLQJLVKHOGWRSURYLGHWKHSHWLWLRQHUZLWKJXLGDQFHIURP DOO&LW\VWDGHSDUWPHQWVWRHQVXUHWKHSHWLWLRQHULVDZDUHRIDOOUHTXLUHPHQWVDQGUHJXODWLRQVIRUWKHLU GHYHORSPHQW8SRQUHFRPPHQGDWLRQE\WKH3ODQ&RXQFLOWKHSHWLWLRQHUZLOOPRYHIRUZDUGWRWKH (FRQRPLF'HYHORSPHQW&RPPLWWHH STEP2 PLAN COUNCIL MEETS ON THE 2ND & 4TH THURSDAY OF THE MONTH APPLICATION FOR REZONING United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us 7KHSHWLWLRQHUPXVWSUHVHQWWKHSURSRVHGSODQWRWKH(FRQRPLF'HYHORSPHQW&RPPLWWHH7KHFRPPLWWHH FRQVLVWVRIIRXUDOGHUPDQZKRZLOOSURYLGHIHHGEDFNWRWKHSHWLWLRQHUUHJDUGLQJWKHLUUHTXHVW7KLV IHHGEDFNDOORZVWKHSHWLWLRQHUWRJDWKHUFRPPHQWVDQGFRQFHUQVSULRUWRIXOO&LW\&RXQFLOFRQVLGHUDWLRQV ,WDOVRDOORZVWKH&LW\&RXQFLOPHPEHUVWRUHYLHZWKHUHTXHVWSULRUWRLWVDUULYDODW&LW\&RXQFLO STEP3 ECONOMIC DEVELOPMENT COMMITTEE MEETS ON THE 1ST TUESDAY OF THE MONTH 7KHSHWLWLRQHUZLOODWWHQGDQGSUHVHQWWKHLUUHTXHVWDWDSXEOLFKHDULQJFRQGXFWHGE\WKH3ODQQLQJDQG =RQLQJ&RPPLVVLRQ7KH3ODQQLQJDQG=RQLQJ&RPPLVVLRQZLOOFRQGXFWDSXEOLFKHDULQJRQWKHUHTXHVW WDNHSXEOLFFRPPHQWVGLVFXVVWKHUHTXHVWDQGPDNHDUHFRPPHQGDWLRQWR&LW\&RXQFLO1RUH]RQLQJ UHTXHVWVKDOOEHUHFRPPHQGHGE\WKH3ODQQLQJDQG=RQLQJ&RPPLVVLRQXQOHVVLWIROORZVWKHVWDQGDUGV VHWIRUWKLQ&LW\·V=RQLQJ2UGLQDQFH 7KHSHWLWLRQHULVUHVSRQVLEOHIRUVHQGLQJFHUWLÀHGSXEOLFKHDULQJQRWLFHVWRDGMDFHQWSURSHUW\RZQHUV ZLWKLQÀYHKXQGUHG IHHWRIWKHVXEMHFWSURSHUW\QROHVVWKDQÀIWHHQ GD\VDQGQRPRUHWKDQWKLUW\ GD\VSULRUWRWKHSXEOLFKHDULQJGDWH7KHSXEOLFKHDULQJQRWLFHZLOOEHGUDIWHGE\WKH&LW\DVZHOODV SXEOLVKHGLQDORFDOQHZVSDSHU$GGLWLRQDOO\DSXEOLFKHDULQJQRWLFHVLJQPXVWEHSODFHGRQWKHSURSHUW\ QROHVVWKDQÀIWHHQ GD\VSULRUWRWKHSXEOLFKHDULQJ $ FHUWLÀHG DGDYLW PXVW EH ÀOHG E\ WKH SHWLWLRQHU ZLWK WKH &RPPXQLW\ 'HYHORSPHQW 'HSDUWPHQW FRQWDLQLQJWKHQDPHVDGGUHVVHVDQGSHUPDQHQWSDUFHOQXPEHUVRIDOOSDUWLHVWKDWZHUHQRWLÀHG7KH &HUWLÀHG0DLOLQJ$GDYLWIRUPLVDWWDFKHGWRWKLVGRFXPHQW STEP4 PLANNING & ZONING COMMISSION MEETS ON THE 2ND WEDNESDAY OF THE MONTH 7KHSHWLWLRQHUZLOODWWHQGWKH&LW\&RXQFLOPHHWLQJZKHUHWKHUHFRPPHQGDWLRQRIWKHVSHFLDOXVHZLOOEH FRQVLGHUHG&LW\&RXQFLOZLOOPDNHWKHÀQDODSSURYDORIWKHVSHFLDOXVH,IDSSURYHG&LW\VWDZLOOKDYHD GUDIWHGRUGLQDQFHWREHVLJQHGE\WKH&RXQFLODQGPXVWEHUHFRUGHGZLWKWKH&RXQW\&OHUNEHIRUHDQ\ IXUWKHUVWHSVPD\EHWDNHQE\WKHSHWLWLRQHU STEP5 CITY COUNCIL MEETS ON THE 2ND & 4TH TUESDAY OF THE MONTH SUMMARY OF RESPONSIBILITIES %HORZLVDVXPPDU\EUHDNGRZQRIZKDWZLOOEHUHTXLUHGE\WKHSHWLWLRQHUDQGZKDWZLOOEHFRPSOHWHGE\WKH&LW\ 6LJQHGDQG1RWDUL]HG$SSOLFDWLRQ 5HTXLUHG3ODQV([KLELWVDQG)HHV &HUWLÀHG0DLOLQJRI3XEOLF1RWLFH 6LJQHG&HUWLÀHG$GDYLWRI0DLOLQJV $WWHQGDQFHDW$OO0HHWLQJV 'HWDLOHG6FKHGXOH$IWHU&RPSOHWH6XEPLVVLRQ 3XEOLF+HDULQJ1RWLFH/DQJXDJH 3RVWLQJRIWKH3XEOLF1RWLFHLQD/RFDO1HZVSDSHU 3XEOLF+HDULQJ6LJQ$SSOLFDWLRQ 'UDIW2UGLQDQFH 6LJQDWXUHVIRU5HFRUGLQJPETITIONERCITY STAFF APPLICATION FOR REZONING United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us DORMANT APPLICATIONS 7KH&RPPXQLW\'HYHORSPHQW'LUHFWRUVKDOOGHWHUPLQHLIDQDSSOLFDWLRQPHHWVRUIDLOVWRPHHWWKHVXEPLVVLRQUHTXLUHPHQWV,IWKH 'LUHFWRUGHWHUPLQHVWKDWWKHDSSOLFDWLRQLVLQFRPSOHWHLWZLOOEHFRPHGRUPDQWXQGHUWKHVHFLUFXPVWDQFHV •7KHDSSOLFDQWKDVEHHQQRWLÀHGRIVXFKGHÀFLHQFLHVDQGKDVQRWUHVSRQGHGRUSURYLGHGDWLPHOLQHIRUFRPSOHWLQJWKH DSSOLFDWLRQZLWKLQQLQHW\ GD\VIURPWKHWLPHRIQRWLÀFDWLRQ •7KHDSSOLFDQWKDVQRWUHVSRQGHGLQZULWLQJWRDUHTXHVWIRULQIRUPDWLRQRUGRFXPHQWDWLRQIURPWKHLQLWLDOSODQQLQJDQG ]RQLQJFRPPLVVLRQUHYLHZZLWKLQVL[ PRQWKVIURPWKHGDWHRIWKDWUHTXHVW •7KHDSSOLFDQWKDVQRWUHVSRQGHGWRDUHTXHVWIRUOHJDORUHQJLQHHULQJGHSRVLWUHSOHQLVKPHQWIRUFLW\LQFXUUHGFRVWVDQGIHHV ZLWKLQQLQHW\ GD\VIURPWKHGDWHRIWKHUHTXHVW ,IWKH&RPPXQLW\'HYHORSPHQW'LUHFWRUKDVVHQWWKHUHTXLUHGQRWLFHDQGWKHDSSOLFDQWKDVQRWZLWKGUDZQWKHLUDSSOLFDWLRQ RUEURXJKWLWLQWRFRPSOLDQFHWKHQWKHGLUHFWRUVKDOOWHUPLQDWHWKHDSSOLFDWLRQ$IWHUWHUPLQDWLRQWKHDSSOLFDWLRQVKDOOQRWEH UHFRQVLGHUHGH[FHSWDIWHUWKHÀOLQJRIDFRPSOHWHO\QHZDSSOLFDWLRQ :LWKGUDZDORUWHUPLQDWLRQRIDQDSSOLFDWLRQVKDOOQRWDHFWWKHDSSOLFDQW·VUHVSRQVLELOLW\IRUSD\PHQWRIDQ\FRVWVDQGIHHVRUDQ\ RWKHURXWVWDQGLQJGHEWRZHGWRWKHFLW\7KHEDODQFHRIDQ\IXQGVGHSRVLWHGZLWKWKHFLW\WKDWLVQRWQHHGHGWRSD\IRUFRVWVDQG IHHVVKDOOEHUHWXUQHGWRWKHDSSOLFDQW 2UG SAMPLE MEETING SCHEDULE MONTH 1 MONTH 2 MONTH 3 MONTH 4 Su M Tu W Th F Sa 12 3456789 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 Su M Tu W Th F Sa 1234567 8 9 1011121314 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 Su M Tu W Th F Sa 1234567 8 9 1011121314 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 Su M Tu W Th F Sa 12345 6789101112 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 City CouncilPlanning & Zoning Commission Public HearingEconomic Development CommitteePlan Council Meeting 7KLVLVDVDPSOHRIZKDWDVFKHGXOHPD\ORRNOLNHDIWHUVXEPLVVLRQ7KH6WHS6XEPLVVLRQPXVWEHFRPSOHWHGEHIRUHWKH3ODQ &RXQFLO0HHWLQJFDQEHVFKHGXOHG7KLVWLPHOLQHUHSUHVHQWVDQLGHDOVFKHGXOH7KURXJKRXWWKHUHYLHZSURFHVVWKHUHPD\EH UHTXHVWVRUFKDQJHVWRWKHVXEPLVVLRQUHTXHVWHGE\WKHFRPPLWWHHVZKLFKPD\GHOD\WKHPHHWLQJVFKHGXOH$VLOOXVWUDWHGWKHUH LVDVPDOODPRXQWRIWLPHEHWZHHQPHHWLQJGDWHVDQGWKHGHDGOLQHIRUXSGDWHGPDWHULDOVWREHVXEPLWWHGIRUUHYLHZ'HSHQGLQJ RQWKHFRPSOH[LW\DQGQDWXUHRIWKHUHTXHVWWKLVWLPHOLQHPD\EHH[WHQGHGWRJLYHWKHSHWLWLRQHUDQGVWDHQRXJKWLPHWRUHYLHZ UHTXHVWHGXSGDWHVWRWKHVXEPLVVLRQ Public Notice Mailing WindowMeeting Date Updated Materials Submitted for Meeting APPLICATION FOR REZONING United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us INVOICE & WORKSHEET PETITION APPLICATION CONCEPT PLAN REVIEW Engineering Plan Review deposit $500.00 Total: $ AMENDMENT Annexation Plan Plat P.U.D. $500.00 $500.00 $500.00 $500.00 Total: $ ANNEXATION $250.00 + $10 per acre for each acre over 5 acres Total: $ ____________ - 5 = ____________ x $10 = ____________ + $250 = $ ____________ # of Acres Acres over 5 Amount for Extra Acres Total Amount REZONING $200.00 + $10 per acre for each acre over 5 acres Total: $ If annexing and rezoning, charge only 1 per acre fee; if rezoning to a PUD, charge PUD Development Fee - not Rezoning Fee ____________ - 5 = ____________ x $10 = ____________ + $200 = $ ____________ # of Acres Acres over 5 Amount for Extra Acres Total Amount SPECIAL USE $250.00 + $10 per acre for each acre over 5 acres Total: $ ____________ - 5 = ____________ x $10 = ____________ + $250 = $ ____________ # of Acres Acres over 5 Amount for Extra Acres Total Amount ZONING VARIANCE $85.00 + $500.00 outside consultants deposit Total: $ PRELIMINARY PLAN FEE $500.00 Total: $ PUD FEE $500.00 Total: $ FINAL PLAT FEE $500.00 Total: $ ENGINEERING PLAN REVIEW DEPOSIT Less than 1 acre Over 1 acre, less than 10 acres Over 10 acres, less than 40 acres Over 40 acres, less than 100 acres Over 100 acres $5,000.00 $10,000.00 $15,000.00 $20,000.00 $25,000.00 Total: $ OUTSIDE CONSULTANTS DEPOSIT Legal, land planner, zoning coordinator, environmental services Total: $ For Annexation, Subdivision, Rezoning, and Special Use: Less than 2 acres Over 2 acres, less than 10 acres Over 10 acres $1,000.00 $2,500.00 $5,000.00 TOTAL AMOUNT DUE: ✔ 25 20 200 450 450 ✔ 400 25 20 200 400 ✔ 450 25 20 200 450 ✔ 5000 ✔ 5000 11300 APPLICATION FOR REZONING United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us DATE: PZC NUMBER: DEVELOPMENT NAME: PETITIONER INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: BUSINESS HOME EMAIL: FAX: PROPERTY INFORMATION NAME OF HOLDER OF LEGAL TITLE: IF LEGAL TITLE IS HELD BY A LAND TRUST, LIST THE NAMES OF ALL HOLDERS OF ANY BENEFICIAL INTEREST THEREIN: PROPERTY STREET ADDRESS: DESCRIPTION OF PROPERTY’S PHYSICAL LOCATION: CURRENT ZONING CLASSIFICATION: REQUESTED ZONING CLASSIFICATION: COMPREHENSIVE PLAN FUTURE LAND USE DESIGNATION: TOTAL ACREAGE: ZONING AND LAND USE OF SURROUNDING PROPERTIES NORTH: EAST: SOUTH: WEST: KENDALL COUNTY PARCEL IDENTIFICATION NUMBER(S) 11/1/2022 Beecher Road Beecher Solar 1, LLC New Leaf Energy Inc. 55 Technology Dr Suite #102 Lowell, MA, 01851 978-221-3103 dsmith@newleafenergy.com Robert M. and Ildefonsa Loftus Robert M. and Ildefonsa Loftus Beecher Road, Yorkville, IL 60401 An existing farmland located at parcels 02-18-400-005, 02-18-400-006, and 02-17-300-002, east of Beecher Road in Yorkville, IL. A-1 A-1 Solar Farm 27.63 A-1 A-1 A-1 A-1 02-18-400-005 02-18-400-006 02-17-300-002 ● APPLICATION FOR REZONING United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us ATTORNEY INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: ENGINEER INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: LAND PLANNER/SURVEYOR INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: ATTACHMENTS Petitioner must attach a legal description of the property to this application and title it as “Exhibit A”. Petitioner must list the names and addresses of any adjoining or contiguous landowners within five hundred (500) feet of the property that are entitled notice of application under any applicable City Ordinance or State Statute. Attach a separate list to this application and title it as “Exhibit B”. Michael Massie Massie & Quick, LLC 115 NW 3rd Ave, PO Box 205 Galva, IL, 61436 309-932-2168 mike@massielaw.net Tony Puljic New Leaf Energy Inc. 55 Technology Dr Suite #102 Lowell, MA, 01851 773-406-9565 tpuljic@newleafenergy.com Marisa Kolman Greenberg Farrow 21 South Evergreen Avenue Suite 200 Arlington Heights, IL, 60005 847-788-9200 mkolman@greenbergfarrow.com APPLICATION FOR REZONING United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us REZONING STANDARDS PLEASE STATE THE EXISTING ZONING CLASSIFICATION(S) AND USES OF THE PROPERTY WITHIN THE GENERAL AREA OF THE PROPOSED REZONED PROPERTY: PLEASE STATE THE TREND OF DEVELOPMENT, IF ANY, IN THE GENERAL AREA OF THE PROPERTY IN QUESTION, INCLUDING CHANGES, IF ANY, WHICH HAVE TAKEN PLACE SINCE THE DAY THE PROPERTY IN QUESTION WAS PLACED IN ITS PRESENT ZONING CLASSIFICATION: PLEASE STATE THE EXTENT TO WHICH PROPERTY VALUES ARE DIMINISHED BY THE PARTICULAR ZONING RESTRICTIONS: PLEASE STATE THE EXTENT TO WHICH THE DESTRUCTION OF PROPERTY VALUES OF PETITIONER PROMOTES THE HEALTH, SAFETY, MORALS, AND GENERAL WELFARE OF THE PUBLIC: The site is located in an area with very low population density and is not anticipated to affect the publics comfort or welfare. The proposed community solar farm is a quiet neighbor and a low-impact use which once built, has no on-site employees and will not add to neighborhood traffic. This development as proposed will not impede the development of adjacent properties for uses already permitted in the adjacent A-1 Zoning Districts. The proposed solar development does not require access to traditional utilities such as natural gas, water or sanitary sewer. The routing of the electrical infrastructure required to connect to the ComEd electric system is shown on the enclosed plans. APPLICATION FOR REZONING United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us REZONING STANDARDS PLEASE STATE THE LENGTH OF TIME THE PROPERTY HAS BEEN VACANT AS ZONED CONSIDERED IN THE CONTEXT OF LAND DEVELOPMENT IN THE AREA IN THE VICINITY OF THE SUBJECT PROPERTY: PLEASE STATE THE COMMUNITY NEED FOR THE PROPOSED LAND USE: WITH RESPECT TO THE SUBJECT PROPERTY, PLEASE STATE THE CARE WITH WHICH THE COMMUNITY HAS UNDERTAKEN TO PLAN ITS LAND USE DEVELOPMENT: PLEASE STATE THE IMPACT THAT SUCH RECLASSIFICATION WILL HAVE UPON TRAFFIC AND TRAFFIC CONDITIONS ON SAID ROUTES; THE EFFECT, IF ANY, SUCH RECLASSIFICATION AND/OR ANNEXATION WOULD HAVE UPON EXISTING ACCESSES TO SAID ROUTES; AND THE IMPACT OF ADDITIONAL ACCESSES AS REQUESTED BY THE PETITIONER UPON TRAFFIC AND TRAFFIC CONDITIONS AND FLOW ON SAID ROUTES (ORD. 1976-43, 11-4-1976): The property is very similar in character to surrounding properties, as it has been farmed for a substantial period of time. It is not vacant, but is not able to be developed for higher and better uses under it's current zoning category. The proposed project is a renewable energy project that will provide clean energy for the community. The property is concurrently proposed for annexation in to the City of Yorkville. The proposed use will be compatible with land use plans in the area. The reclassification of the property to allow for development of the solar project will not generate substantial traffic. The facility will operate unmanned and will have 3-4 visits per year for maintenance activities. No negative impacts to the traffic conditions in the area are anticipated. The public will benefit from the availability of a new renewable power source. The owner will benefit from income generated by the lease of the property, that can support continued farming use on other lands. The project is located on the outskirts of the City of Yorkville, in a sparsely populated area. However, there are residential developments not far from the parcel. The use is an appropriate transition for the rural farming community to the more suburban character of other projects nearer to the City center. APPLICANT DEPOSIT ACCOUNT/ ACKNOWLEDGMENT OF FINANCIAL RESPONSIBILITY United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us PRINT NAME SIGNATURE* TITLE DATE PROJECT NUMBER: FUND ACCOUNT NUMBER: PROPERTY ADDRESS: PETITIONER DEPOSIT ACCOUNT FUND: It is the policy of the United City of Yorkville to require any petitioner seeking approval on a project or entitlement request to establish a Petitioner Deposit Account Fund to cover all actual expenses occurred as a result of processing such applications and requests. Typical requests requiring the establishment of a Petitioner Deposit Account Fund include, but are not limited to, plan review of development approvals/engineering permits. Deposit account funds may also be used to cover costs for services related to legal fees, engineering and other plan reviews, processing of other governmental applications, recording fees and other outside coordination and consulting fees. Each fund account is established with an initial deposit based upon the estimated cost for services provided in the INVOICE & WORKSHEET PETITION APPLICATION. This initial deposit is drawn against to pay for these services related to the project or request. Periodically throughout the project review/approval process, the Financially Responsible Party will receive an invoice reflecting the charges made against the account. At any time the balance of the fund account fall below ten percent (10%) of the original deposit amount, the Financially Responsible Party will receive an invoice requesting additional funds equal to one-hundred percent (100%) of the initial deposit if subsequent reviews/fees related to the project are required. In the event that a deposit account is not immediately replenished, review by the administrative staff, consultants, boards and commissions may be suspended until the account is fully replenished. If additional funds remain in the deposit account at the completion of the project, the city will refund the balance to the Financially Responsible Party. A written request must be submitted by the Financially Responsible Party to the city by the 15th of the month in order for the refund check to be processed and distributed by the 15th of the following month. All refund checks will be made payable to the Financially Responsible Party and mailed to the address provided when the account was established. ACKNOWLEDGMENT OF FINANCIAL RESPONSIBILITY NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: FINANCIALLY RESPONSIBLE PARTY: I acknowledge and understand that as the Financially Responsible Party, expenses may exceed the estimated initial deposit and, when requested by the United City of Yorkville, I will provide additional funds to maintain the required account balance. Further, the sale or other disposition of the property does not relieve the individual or Company/Corporation of their obligation to maintain a positive balance in the fund account, unless the United City of Yorkville approves a Change of Responsible Party and transfer of funds. Should the account go into deficit, all City work may stop until the requested replenishment deposit is received. *The name of the individual and the person who signs this declaration must be the same. If a corporation is listed, a corporate officer must sign the declaration (President, Vice- President, Chairman, Secretary or Treasurer) INITIAL ENGINEERING/LEGAL DEPOSIT TOTALS ENGINEERING DEPOSITS: Up to one (1) acre Over one (1) acre, but less than ten (10) acres Over ten (10) acres, but less than forty (40) acres Over forty (40) acres, but less than one hundred (100) In excess of one hundred (100.00) acres $5,000 $10,000 $15,000 $20,000 $25,000 LEGAL DEPOSITS: Less than two (2) acres Over two (2) acres, but less than ten (10) acres Over ten (10) acres $1,000 $2,500 $5,000 Beecher Solar 1, LLC By 1115 Solar Development, LLC, its sole member and manager Beecher Road, Yorkville, IL 60401 Brendan Neagle New Leaf Energy Inc. 55 Technology Dr Suite #102 Lowell, MA, 01851 978-513-2613 bneagle@newleafenergy.com Brendan Neagle EVP Project Finance CERTIFIED MAILING AFFIDAVIT STATE OF ILLINOIS ) ) SS COUNTY OF KENDALL ) I/We, ________________________, petitioner, being first duly sworn, do hereby state under oath that to the best of my knowledge the attached list is a true, correct and complete list of all permanent parcel numbers, and names and addresses of owners, of all lots and parts of lots located within 500 feet (exclusively of any public streets and alleys) of the property legally described on the attached application for annexation, rezoning, special use permit, planned unit development, variation, or other zoning amendment. I further state that said list was obtained from the current tax rolls of the Kendall County Treasurer’s Office. I further state that I mailed by U.S. Certified Mail, Return Receipt Requested, a copy of the Public Notice of Public Hearing before the United City of Yorkville Planning and Zoning Commission for the Public Hearing held on Wednesday, _______________, at the United City of City Council Chambers, Yorkville, Illinois. The notice was mailed to the attached list of all of the permanent parcel numbers and names and addresses of owners at the U.S. Post office on _______________________, 20_____. ________________________________ Signature of Petitioner(s) Subscribed and sworn to before me this ________ day of _______________, 20______ ______________________________________ Notary Public To be provided later PERMIT NUMBER: DATE/TIME RECEIVED: SITE ADDRESS: PARCEL NUMBER: SUBDIVISION: LOT/UNIT: APPLICANT INFORMATION NAME: TELEPHONE: HOME BUSINESS ADDRESS: E-MAIL: HOME BUSINESS CITY, STATE, ZIP: FAX: SIGN INFORMATION DATE OF PICK UP: NUMBER OF SIGNS: DATE OF PUBLIC HEARING: SIGN RETURN DATE: The undersigned hereby states that they have acquired Public Hearing Signs from the United City of Yorkville’s Community Development Department and agrees to return said sign/s to Yorkville City Hall, 800 Game Farm Road, Yorkville, Illinois, immediately following the date of the public hearing. Petitioner or Representative agrees to pay to the United City of Yorkville a deposit of $50 for each sign. The deposit will be returned to the petitioner when the public hearing sign/s have been returned to the City. Petitioner or Representative further agrees to pay to the United City of Yorkville the full amount of the purchase price for each sign not returned to the United City of Yorkville within seven (7) days after the date of the public hearing. ___________________________________________________________________________ __________________________________ SIGNATURE/AUTHORIZED AGENT DATE DATE RETURNED: _____________________________________________________ RECEIVED BY: _______________________________________________________ PZC# ______________________________ APPLICATION FOR PUBLIC HEARING SIGN 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us 02-18-400-005, 02-18-400-006, 02-17-300-002Beecher Road, Yorkville, IL 60401 Beecher Solar 1, LLC 55 Technology Dr Suite #102 Lowell, MA, 01851 978-221-3103 dsmith@newleafenergy.com 11/11/22 APPLICATION FOR SPECIAL USE United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us INTENT AND PURPOSE The purpose of the zoning code is based upon the authority of the City to divide its land into districts by use, bulk, and structures, in a substantially uniform manner. It is recognized that while some uses are permitted under the zoning code to keep uniformity, a case-by-case analysis must be conducted for certain permitted uses to discover the impact of those uses on neighboring land. In these cases a special use must be granted. This packet explains the process to successfully submit and complete an Application for Special Use. It includes a detailed description of the process, outlines required submittal materials, and contains the application for special use. For a complete explanation of what is legally required throughout the Special Use process, please refer to “Title 10, Chapter 4, Section 9: Special Uses” of the Yorkville, Illinois City Code. APPLICATION PROCEDURE STEP1 APPLICATION SUBMITTAL SUBMIT APPLICATION, FEES, AND PLANS TO THE COMMUNITY DEVELOPMENT DEPT. The following must be submitted: One (1) original signed and notarized application. Legal description of the property in Microsoft Word. Three (3) copies each of the exhibits, proposed drawings, location map, and site plan. All exhibits and plans must be an appropriate size for all details and descriptions to be legible. $SSURSULDWH DSSOLFDWLRQ DQG ÀOLQJ IHH &KHFNV PD\ EH ZULWWHQ WR WKH 8QLWHG &LW\ RI <RUNYLOOH Signed Applicant Deposit Account/Acknowledgment of Financial Responsibility form. One (1) electronic copy (PDF) of all materials submitted including application and exhibits. Within one (1) week of submittal, the Community Development Department will determine if the application is complete or if additional information is needed. An incomplete submittal could delay the scheduling of the project. The petitioner is responsible for payment of recording fees and public hearing costs, including written transcripts of the public hearing and outside consultant costs (i.e. legal review, land planner, zoning coordinator, environmental, etc.). The petitioner will be required to establish a deposit account with the City to cover these fees. 2QFH D VXEPLWWHG DQG FRPSOHWH &RPPXQLW\ 'HYHORSPHQW VWD ZLOO SURYLGH D WHQWDWLYH VFKHGXOH RI meetings as well as all needed documents for the process. The petitioner must present the proposed request to the Plan Council. The members of the Council LQFOXGH WKH &RPPXQLW\ 'HYHORSPHQW 'LUHFWRU &LW\ (QJLQHHU WKH %XLOGLQJ 'HSDUWPHQW 2FLDO WKH Public Works Director, the Director of Parks and Recreation, a Fire Department Representative, and a Police Department Representative. This meeting is held to provide the petitioner with guidance from DOO &LW\ VWD GHSDUWPHQWV WR HQVXUH WKH SHWLWLRQHU LV DZDUH RI DOO UHTXLUHPHQWV DQG UHJXODWLRQV IRU WKHLU development. Upon recommendation by the Plan Council, the petitioner will move forward to the Economic Development Committee. STEP2 PLAN COUNCIL MEETS ON THE 2ND & 4TH THURSDAY OF THE MONTH APPLICATION FOR SPECIAL USE United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us The petitioner must present the proposed plan to the Economic Development Committee. The committee consists of four alderman who will provide feedback to the petitioner regarding their request. This feedback allows the petitioner to gather comments and concerns prior to full City Council considerations. It also allows the City Council members to review the request prior to its arrival at City Council. STEP3 ECONOMIC DEVELOPMENT COMMITTEE MEETS ON THE 1ST TUESDAY OF THE MONTH The petitioner will attend and present their request at a public hearing conducted by the Planning and Zoning Commission. The Planning and Zoning Commission will conduct a public hearing on the request, take public comments, discuss the request, and make a recommendation to City Council. No special use shall be recommended by the Planning and Zoning Commission unless it follows the standards set forth in City’s Zoning Ordinance. 7KH SHWLWLRQHU LV UHVSRQVLEOH IRU VHQGLQJ FHUWLÀHG SXEOLF KHDULQJ QRWLFHV WR DGMDFHQW SURSHUW\ RZQHUV ZLWKLQ ÀYH KXQGUHG IHHW RI WKH VXEMHFW SURSHUW\ QR OHVV WKDQ ÀIWHHQ GD\V DQG QR PRUH WKDQ WKLUW\ (30) days prior to the public hearing date. The public hearing notice will be drafted by the City as well as published in a local newspaper. Additionally, a public hearing notice sign must be placed on the property QR OHVV WKDQ ÀIWHHQ GD\V SULRU WR WKH SXEOLF KHDULQJ $ FHUWLÀHG DGDYLW PXVW EH ÀOHG E\ WKH SHWLWLRQHU ZLWK WKH &RPPXQLW\ 'HYHORSPHQW 'HSDUWPHQW FRQWDLQLQJ WKH QDPHV DGGUHVVHV DQG SHUPDQHQW SDUFHO QXPEHUV RI DOO SDUWLHV WKDW ZHUH QRWLÀHG 7KH &HUWLÀHG 0DLOLQJ $GDYLW IRUP LV DWWDFKHG WR WKLV GRFXPHQW STEP4 PLANNING & ZONING COMMISSION MEETS ON THE 2ND WEDNESDAY OF THE MONTH The petitioner will attend the City Council meeting where the recommendation of the special use will be FRQVLGHUHG &LW\ &RXQFLO ZLOO PDNH WKH ÀQDO DSSURYDO RI WKH VSHFLDO XVH ,I DSSURYHG &LW\ VWD ZLOO KDYH D drafted ordinance to be signed by the Council and must be recorded with the County Clerk before any further steps may be taken by the petitioner. STEP5 CITY COUNCIL MEETS ON THE 2ND & 4TH TUESDAY OF THE MONTH SUMMARY OF RESPONSIBILITIES Below is a summary breakdown of what will be required by the petitioner and what will be completed by the City: Signed and Notarized Application Required Plans, Exhibits, and Fees &HUWLÀHG 0DLOLQJ RI 3XEOLF 1RWLFH 6LJQHG &HUWLÀHG $GDYLW RI 0DLOLQJV Attendance at All Meetings Detailed Schedule After Complete Submission Public Hearing Notice Language Posting of the Public Notice in a Local Newspaper Public Hearing Sign Application Draft Ordinance & Signatures for RecordingPETITIONERCITY STAFF APPLICATION FOR SPECIAL USE United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us DORMANT APPLICATIONS The Community Development Director shall determine if an application meets or fails to meet the submission requirements. If the Director determines that the application is incomplete it will become dormant under these circumstances: •7KH DSSOLFDQW KDV EHHQ QRWLÀHG RI VXFK GHÀFLHQFLHV DQG KDV QRW UHVSRQGHG RU SURYLGHG D WLPH OLQH IRU FRPSOHWLQJ WKH DSSOLFDWLRQ ZLWKLQ QLQHW\ GD\V IURP WKH WLPH RI QRWLÀFDWLRQ • The applicant has not responded in writing to a request for information or documentation from the initial planning and zoning commission review within six (6) months from the date of that request. • The applicant has not responded to a request for legal or engineering deposit replenishment for city incurred costs and fees within ninety (90) days from the date of the request. If the Community Development Director has sent the required notice and the applicant has not withdrawn their application or brought it into compliance, then the director shall terminate the application. After termination, the application shall not be UHFRQVLGHUHG H[FHSW DIWHU WKH ÀOLQJ RI D FRPSOHWHO\ QHZ DSSOLFDWLRQ :LWKGUDZDO RU WHUPLQDWLRQ RI DQ DSSOLFDWLRQ VKDOO QRW DHFW WKH DSSOLFDQW·V UHVSRQVLELOLW\ IRU SD\PHQW RI DQ\ FRVWV DQG IHHV RU DQ\ other outstanding debt owed to the city. The balance of any funds deposited with the city that is not needed to pay for costs and fees shall be returned to the applicant. (Ord. 2011-34, 7-26-2011) SAMPLE MEETING SCHEDULE MONTH 1 MONTH 2 MONTH 3 MONTH 4 Su M Tu W Th F Sa 12 3456789 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 Su M Tu W Th F Sa 1234567 8 9 1011121314 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 Su M Tu W Th F Sa 1234567 8 9 1011121314 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 Su M Tu W Th F Sa 12345 6789101112 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 City CouncilPlanning & Zoning Commission Public HearingEconomic Development CommitteePlan Council Meeting This is a sample of what a schedule may look like after submission. The Step 1 Submission must be completed before the Plan Council Meeting can be scheduled. This timeline represents an ideal schedule. Throughout the review process, there may be requests or changes to the submission requested by the committees which may delay the meeting schedule. As illustrated, there is a small amount of time between meeting dates and the deadline for updated materials to be submitted for review. Depending RQ WKH FRPSOH[LW\ DQG QDWXUH RI WKH UHTXHVW WKLV WLPHOLQH PD\ EH H[WHQGHG WR JLYH WKH SHWLWLRQHU DQG VWD HQRXJK WLPH WR UHYLHZ requested updates to the submission. Public Notice Mailing WindowMeeting Date Updated Materials Submitted for Meeting APPLICATION FOR SPECIAL USE United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us INVOICE & WORKSHEET PETITION APPLICATION CONCEPT PLAN REVIEW Engineering Plan Review deposit $500.00 Total: $ AMENDMENT Annexation Plan Plat P.U.D. $500.00 $500.00 $500.00 $500.00 Total: $ ANNEXATION $250.00 + $10 per acre for each acre over 5 acres Total: $ ____________ - 5 = ____________ x $10 = ____________ + $250 = $ ____________ # of Acres Acres over 5 Amount for Extra Acres Total Amount REZONING $200.00 + $10 per acre for each acre over 5 acres Total: $ If annexing and rezoning, charge only 1 per acre fee; if rezoning to a PUD, charge PUD Development Fee - not Rezoning Fee ____________ - 5 = ____________ x $10 = ____________ + $200 = $ ____________ # of Acres Acres over 5 Amount for Extra Acres Total Amount SPECIAL USE $250.00 + $10 per acre for each acre over 5 acres Total: $ ____________ - 5 = ____________ x $10 = ____________ + $250 = $ ____________ # of Acres Acres over 5 Amount for Extra Acres Total Amount ZONING VARIANCE $85.00 + $500.00 outside consultants deposit Total: $ PRELIMINARY PLAN FEE $500.00 Total: $ PUD FEE $500.00 Total: $ FINAL PLAT FEE $500.00 Total: $ ENGINEERING PLAN REVIEW DEPOSIT Less than 1 acre Over 1 acre, less than 10 acres Over 10 acres, less than 40 acres Over 40 acres, less than 100 acres Over 100 acres $5,000.00 $10,000.00 $15,000.00 $20,000.00 $25,000.00 Total: $ OUTSIDE CONSULTANTS DEPOSIT Legal, land planner, zoning coordinator, environmental services Total: $ For Annexation, Subdivision, Rezoning, and Special Use: Less than 2 acres Over 2 acres, less than 10 acres Over 10 acres $1,000.00 $2,500.00 $5,000.00 TOTAL AMOUNT DUE: 25 20 200 450 450 400 25 20 200 400 25 20 200 450 450 5000 5000 11300 APPLICATION FOR SPECIAL USE United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us DATE: PZC NUMBER: DEVELOPMENT NAME: PETITIONER INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: BUSINESS HOME EMAIL: FAX: PROPERTY INFORMATION NAME OF HOLDER OF LEGAL TITLE: IF LEGAL TITLE IS HELD BY A LAND TRUST, LIST THE NAMES OF ALL HOLDERS OF ANY BENEFICIAL INTEREST THEREIN: PROPERTY STREET ADDRESS: DESCRIPTION OF PROPERTY’S PHYSICAL LOCATION: CURRENT ZONING CLASSIFICATION: COMPREHENSIVE PLAN FUTURE LAND USE DESIGNATION: REQUESTED SPECIAL USE: ZONING AND LAND USE OF SURROUNDING PROPERTIES NORTH: EAST: SOUTH: WEST: KENDALL COUNTY PARCEL IDENTIFICATION NUMBER(S) 11/1/2022 Beecher Road Beecher Solar 1, LLC New Leaf Energy Inc. 55 Technology Dr Suite #102 Lowell, MA, 01851 ●978-221-3103 dsmith@newleafenergy.com Robert M. and Ildefonsa Loftus Robert M. and Ildefonsa Loftus Beecher Road, Yorkville, IL 60401 An existing farmland located at parcels 02-18-400-005, 02-18-400-006, and 02-17-300-002, east of Beecher Road in Yorkville, IL. A-1 Solar Farm Solar Farm A-1 A-1 A-1 A-1 02-18-400-005 02-18-400-006 02-17-300-002 APPLICATION FOR SPECIAL USE United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us ATTORNEY INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: ENGINEER INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: LAND PLANNER/SURVEYOR INFORMATION NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: ATTACHMENTS Petitioner must attach a legal description of the property to this application and title it as “Exhibit A”. Petitioner must list the names and addresses of any adjoining or contiguous landowners within five hundred (500) feet of the property that are entitled notice of application under any applicable City Ordinance or State Statute. Attach a separate list to this application and title it as “Exhibit B”. Michael Massie Massie & Quick, LLC 115 NW 3rd Ave, PO Box 205 Galva, IL, 61436 309-932-2168 mike@massielaw.net Tony Puljic New Leaf Energy Inc. 55 Technology Dr Suite #102 Lowell, MA, 01851 773-406-9565 tpuljic@newleafenergy.com Marisa Kolman Greenberg Farrow 21 South Evergreen Avenue Suite 200 Arlington Heights, IL, 60005 847-788-9200 mkolman@greenbergfarrow.com APPLICATION FOR SPECIAL USE United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us SPECIAL USE STANDARDS PLEASE STATE HOW THE ESTABLISHMENT, MAINTENANCE OR OPERATION OF THE SPECIAL USE WILL NOT BE UNREASONABLY DETRIMENTAL TO OR ENDANGER THE PUBLIC HEALTH, SAFETY, MORALS, COMFORT OR GENERAL WELFARE: PLEASE STATE HOW THE SPECIAL USE WILL NOT BE INJURIOUS TO THE USE AND ENJOYMENT OF OTHER PROPERTY IN THE IMMEDIATE VICINITY FOR THE PURPOSE ALREADY PERMITTED, NOR SUBSTANTIALLY DIMINISH AND IMPAIR PROPERTY VALUES WITHIN THE NEIGHBORHOOD: PLEASE STATE HOW THE ESTABLISHMENT OF THE SPECIAL USE WILL NOT IMPEDE THE NORMAL AND ORDERLY DEVELOPMENT AND IMPROVEMENT OF SURROUNDING PROPERTY FOR USES PERMITTED IN THE DISTRICT: PLEASE STATE HOW ADEQUATE UTILITIES, ACCESS ROADS, DRAINAGE OR OTHER NECESSARY FACILITIES HAVE BEEN OR ARE BEING PROVIDED: The site is located in an area with very low population density and is not anticipated to affect the publics comfort or welfare. The proposed community solar farm is a quiet neighbor and a low-impact use which once built, has no on-site employees and will not add to neighborhood traffic. This development as proposed will not impede the development of adjacent properties for uses already permitted in the adjacent A-1 Zoning Districts. The proposed solar development does not require access to traditional utilities such as natural gas, water or sanitary sewer. The routing of the electrical infrastructure required to connect to the ComEd electric system is shown on the enclosed plans. APPLICANT DEPOSIT ACCOUNT/ ACKNOWLEDGMENT OF FINANCIAL RESPONSIBILITY United City of Yorkville 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us PRINT NAME SIGNATURE* TITLE DATE PROJECT NUMBER: FUND ACCOUNT NUMBER: PROPERTY ADDRESS: PETITIONER DEPOSIT ACCOUNT FUND: It is the policy of the United City of Yorkville to require any petitioner seeking approval on a project or entitlement request to establish a Petitioner Deposit Account Fund to cover all actual expenses occurred as a result of processing such applications and requests. Typical requests requiring the establishment of a Petitioner Deposit Account Fund include, but are not limited to, plan review of development approvals/engineering permits. Deposit account funds may also be used to cover costs for services related to legal fees, engineering and other plan reviews, processing of other governmental applications, recording fees and other outside coordination and consulting fees. Each fund account is established with an initial deposit based upon the estimated cost for services provided in the INVOICE & WORKSHEET PETITION APPLICATION. This initial deposit is drawn against to pay for these services related to the project or request. Periodically throughout the project review/approval process, the Financially Responsible Party will receive an invoice reflecting the charges made against the account. At any time the balance of the fund account fall below ten percent (10%) of the original deposit amount, the Financially Responsible Party will receive an invoice requesting additional funds equal to one-hundred percent (100%) of the initial deposit if subsequent reviews/fees related to the project are required. In the event that a deposit account is not immediately replenished, review by the administrative staff, consultants, boards and commissions may be suspended until the account is fully replenished. If additional funds remain in the deposit account at the completion of the project, the city will refund the balance to the Financially Responsible Party. A written request must be submitted by the Financially Responsible Party to the city by the 15th of the month in order for the refund check to be processed and distributed by the 15th of the following month. All refund checks will be made payable to the Financially Responsible Party and mailed to the address provided when the account was established. ACKNOWLEDGMENT OF FINANCIAL RESPONSIBILITY NAME: COMPANY: MAILING ADDRESS: CITY, STATE, ZIP: TELEPHONE: EMAIL: FAX: FINANCIALLY RESPONSIBLE PARTY: I acknowledge and understand that as the Financially Responsible Party, expenses may exceed the estimated initial deposit and, when requested by the United City of Yorkville, I will provide additional funds to maintain the required account balance. Further, the sale or other disposition of the property does not relieve the individual or Company/Corporation of their obligation to maintain a positive balance in the fund account, unless the United City of Yorkville approves a Change of Responsible Party and transfer of funds. Should the account go into deficit, all City work may stop until the requested replenishment deposit is received. *The name of the individual and the person who signs this declaration must be the same. If a corporation is listed, a corporate officer must sign the declaration (President, Vice- President, Chairman, Secretary or Treasurer) INITIAL ENGINEERING/LEGAL DEPOSIT TOTALS ENGINEERING DEPOSITS: Up to one (1) acre Over one (1) acre, but less than ten (10) acres Over ten (10) acres, but less than forty (40) acres Over forty (40) acres, but less than one hundred (100) In excess of one hundred (100.00) acres $5,000 $10,000 $15,000 $20,000 $25,000 LEGAL DEPOSITS: Less than two (2) acres Over two (2) acres, but less than ten (10) acres Over ten (10) acres $1,000 $2,500 $5,000 Beecher Solar 1, LLC By 1115 Solar Development, LLC, its sole member and manager Beecher Road, Yorkville, IL 60401 Brendan Neagle New Leaf Energy Inc. 55 Technology Dr Suite #102 Lowell, MA, 01851 978-513-2613 bneagle@newleafenergy.com Brendan Neagle EVP Project Finance CERTIFIED MAILING AFFIDAVIT STATE OF ILLINOIS ) ) SS COUNTY OF KENDALL ) I/We, ________________________, petitioner, being first duly sworn, do hereby state under oath that to the best of my knowledge the attached list is a true, correct and complete list of all permanent parcel numbers, and names and addresses of owners, of all lots and parts of lots located within 500 feet (exclusively of any public streets and alleys) of the property legally described on the attached application for annexation, rezoning, special use permit, planned unit development, variation, or other zoning amendment. I further state that said list was obtained from the current tax rolls of the Kendall County Treasurer’s Office. I further state that I mailed by U.S. Certified Mail, Return Receipt Requested, a copy of the Public Notice of Public Hearing before the United City of Yorkville Planning and Zoning Commission for the Public Hearing held on Wednesday, _______________, at the United City of City Council Chambers, Yorkville, Illinois. The notice was mailed to the attached list of all of the permanent parcel numbers and names and addresses of owners at the U.S. Post office on _______________________, 20_____. ________________________________ Signature of Petitioner(s) Subscribed and sworn to before me this ________ day of _______________, 20______ ______________________________________ Notary Public To be provided later PERMIT NUMBER: DATE/TIME RECEIVED: SITE ADDRESS: PARCEL NUMBER: SUBDIVISION: LOT/UNIT: APPLICANT INFORMATION NAME: TELEPHONE: HOME BUSINESS ADDRESS: E-MAIL: HOME BUSINESS CITY, STATE, ZIP: FAX: SIGN INFORMATION DATE OF PICK UP: NUMBER OF SIGNS: DATE OF PUBLIC HEARING: SIGN RETURN DATE: The undersigned hereby states that they have acquired Public Hearing Signs from the United City of Yorkville’s Community Development Department and agrees to return said sign/s to Yorkville City Hall, 800 Game Farm Road, Yorkville, Illinois, immediately following the date of the public hearing. Petitioner or Representative agrees to pay to the United City of Yorkville a deposit of $50 for each sign. The deposit will be returned to the petitioner when the public hearing sign/s have been returned to the City. Petitioner or Representative further agrees to pay to the United City of Yorkville the full amount of the purchase price for each sign not returned to the United City of Yorkville within seven (7) days after the date of the public hearing. ___________________________________________________________________________ __________________________________ SIGNATURE/AUTHORIZED AGENT DATE DATE RETURNED: _____________________________________________________ RECEIVED BY: _______________________________________________________ PZC# ______________________________ APPLICATION FOR PUBLIC HEARING SIGN 800 Game Farm Road Yorkville, Illinois, 60560 Telephone: 630-553-4350 Fax: 630-553-7575 We bsite: www.yorkville.il.us 02-18-400-005, 02-18-400-006, 02-17-300-002Beecher Road, Yorkville, IL 60401 Beecher Solar 1, LLC 55 Technology Dr Suite #102 Lowell, MA, 01851 978-221-3103 dsmith@newleafenergy.com 11/11/22 7HFKQRORJ\'ULYH6XLWH /RZHOO0$ QHZOHDIHQHUJ\FRP '$7( 'HFHPEHU 72 .U\VWL%DUNVGDOH1REOH &RPPXQLW\'HYHORSPHQW 8QLWHG&LW\RI<RUNYLOOH *DPH)DUP5RDG <RUNYLOOHΖ/ 5( 3URMHFW1DUUDWLYH %HHFKHU6RODU//& 3URSRVHG*URXQG0RXQWHG6RODU)DUP %HHFKHU5RDG.HQGDOO&RXQW\ 3Ζ1 352-(&71$55$7Ζ9( 1HZ/HDI(QHUJ\ΖQF 1HZ/HDI LVUHTXHVWLQJD6SHFLDO8VH3HUPLWWRDOORZIRU GHYHORSPHQWRID0:$&FRPPXQLW\VRODUIDUPIDFLOLW\RQDQDSSUR[LPDWHO\DFUH SRUWLRQRIH[LVWLQJIDUPODQGORFDWHGDWDQG HDVWRI%HHFKHU5RDGLQ<RUNYLOOHΖ/7KHSURSHUW\LVDSSUR[LPDWHO\DFUHVLQVL]HDQG LV]RQHG$ $JULFXOWXUH 7KHVLWHLVFXUUHQWO\EHLQJXVHGIRUDJULFXOWXUDOSXUSRVHVDQGWKH UHVLGXDOSDUFHODFUHDJHZLOOEHPDLQWDLQHGE\WKHSURSHUW\RZQHUDQGPD\FRQWLQXHWREH IDUPHGLIWKHSURSHUW\RZQHUFKRRVHVWRGRVR1HZ/HDI(QHUJ\ΖQFLVUHTXHVWLQJD 6SHFLDO8VH3HUPLWWRDOORZIRUWKH6RODU)DUP8VH 7RDVVLVWLQ\RXUUHYLHZRIWKLV6SHFLDO8VH3HUPLWUHTXHVWD6LWH8VH3ODQ6HWKDVEHHQ SURYLGHGZKLFKLOOXVWUDWHVWKHSURSRVHGVRODUIDUPXVHDQGVLWHLPSURYHPHQWV7KHSURMHFW SURSRVHGXVHVDQGLPSURYHPHQWVLQFOXGH •39VRODUSDQHODUUD\VDWPD[LPXPIWLQKHLJKWZLWKWUDFNHUVUDFNLQJVWULQJ LQYHUWHUV5DFNLQJV\VWHPWREHLQVWDOOHGYLDSRVWVRUDXJXUHGVFUHZV3RVWGHSWKLV DQWLFLSDWHGWREHWRIHHWEHORZJUDGHWREHGHWHUPLQHGRQFHJHRWHFKQLFDO LQYHVWLJDWLRQLVFRPSOHWHG •&RQFUHWHSDGPRXQWHGWUDQVIRUPHUVVZLWFKJHDUORFDWHGFHQWUDOWRWKHV\VWHP •'DWD$FTXLVLWLRQ6\VWHP '$6 IRUUHPRWHPRQLWRULQJ •'&FRXSOHG3RZLQ0ZKHQHUJ\VWRUDJHIDFLOLW\ 7HFKQRORJ\'ULYH6XLWH /RZHOO0$ QHZOHDIHQHUJ\FRP •(TXLSPHQWSROHVDQGULVHUSROHVZLWKRYHUKHDGSRZHUOLQHVIRULQWHUFRQQHFWLRQ SRLQWRQ%HHFKHU5RDG2QVLWHSRZHUOLQHVZLOOEHSODFHGXQGHUJURXQGWRWKH PD[LPXPH[WHQWSRVVLEOHXQWLO&RP(GȇVSRLQWRIFRQQHFWLRQ7KLVVFRSHRIZRUNLV SHU&RP(GȇVUHTXLUHPHQWV WKXVWKHILQDOGHVLJQLVSHQGLQJDXWLOLW\VWXG\ •8QGHUJURXQGWUHQFKLQJFDEOLQJ •3HULPHWHUVHFXULW\IHQFLQJDWIWKHLJKWDVUHTXLUHGSHU1DWLRQDO(OHFWULF&RGH 1(& 7KHIHQFHGDUHDRIHDFKSURSRVHG0:$&SURMHFWLVDSSUR[LPDWHO\ DFUHVDQGZLOOLQFOXGHDJDWHGPDLQHQWU\ZLWKDWRWDORIWHQ IRRWJDWHVDQG RQH IRRWJDWHIRUYHKLFOHDFFHVV$.QR[ER[DQGNH\VZLOOEHSURYLGHGDV UHTXLUHGE\WKH&LW\ȇVEXLOGLQJGHSDUWPHQWDQG%ULVWRO.HQGDOO)LUH'LVWULFW %.)' 7KHSURSRVHGIHQFLQJZLOOVHFXUHDOOIRXUVLGHVRIWKHDUUD\ILHOG •/RFDWLRQRISURSRVHGDUUD\ILHOGPHHWVRUH[FHHGV&LW\VHWEDFNUHTXLUHPHQWV 5RDG 5HTXLUHG&HQWHUOLQH 3URSRVHG&HQWHUOLQH %HHFKHU5RDG IW IW 3URSHUW\/LQH 5HTXLUHG6LGH<DUG 3URSRVHG6LGH<DUG 1RUWKHUQ IW IW 6RXWKHUQ IW IW (DVWHUQ 1RQH IW 3URSHUW\/LQH 5HTXLUHG5HDU<DUG 3URSRVHG5HDU<DUG :HVWHUQ IW IW •7KHSURSRVHGVLWHDFFHVVLVYLDDQHZGULYHZD\SURSRVHGDORQJ%HHFKHU5RDG$ IWZLGHJUDYHOGULYHZLOOEHH[WHQGHGIURPWKLVSRLQWWRSURYLGHDFFHVVWR HTXLSPHQWDVZHOODVRQVLWHYHKLFOHPDQHXYHULQJ/D\RXWDQGFRQILJXUDWLRQDUH GHSLFWHGLQWKHSODQV ȏ1RIRUPDOSDUNLQJVWDOOVDUHSURYLGHGDVSRVWFRQVWUXFWLRQWKHUHZLOOEHQR EXLOGLQJVDQGQRHPSOR\HHVRQVLWHRWKHUWKDQRFFDVLRQDOYLVLWVIRUPRZLQJ DQGRUPDLQWHQDQFHOLNHO\WRWLPHVSHU\HDU •'UDLQDJHIORZWKURXJKWKHSURSHUW\ZLOOEHPDLQWDLQHGERWKDWWKHVXUIDFHDQG EHORZJUDGHYLDGUDLQWLOHVDQGWKHUHZLOOEHYHU\OLWWOHJUDGLQJQHFHVVDU\IRU GHYHORSPHQWRIWKLVSURMHFW •3RVWFRQVWUXFWLRQVLWHDUHDZLOOEHVHHGHGZLWKDORZPRZVHHGPL[DQGD ZHHGJUDVVFRQWUROSODQKDVEHHQGHWDLOHGLQWKHSODQV •1RLVHOHYHOVPHDVXUHGDWWKHSURSHUW\OLQHZLOOQRWH[FHHGILIW\ GHFLEHOV 7HFKQRORJ\'ULYH6XLWH /RZHOO0$ QHZOHDIHQHUJ\FRP •2QHPRWLRQVHQVRUVHFXULW\OLJKWZLOOEHSURYLGHGDWHDFKRIWKHWUDQVIRUPHUDUHDV DQGZLOOFRPSO\ZLWKUHTXLUHPHQWVRIWKH&RXQW\/LJKWLQJ2UGLQDQFHȂVHHSODQ GHWDLOVKHHW •$SSURSULDWH1(&VDIHW\VLJQDJHZLOOEHSURYLGHGDORQJWKHSHULPHWHURIWKHSURMHFW •'HFRPPLVVLRQLQJRIWKHSURMHFWXSRQFRPSOHWLRQRIWKHOHDVHWHUPKDVEHHQ FRQWHPSODWHGE\WKHOHDVHDJUHHPHQW$GGLWLRQDOO\ZHKDYHLQFOXGHGZLWKRXU VXEPLVVLRQDGHFRPPLVVLRQLQJSODQVKHHWDQGDGHFRPPLVVLRQLQJSODQHVWLPDWH WKDWLQFOXGHVLQIRUPDWLRQUHJDUGLQJVDOYDJHYDOXH 6XSSOHPHQWDOΖQIRUPDWLRQ •$ZHWODQGGHOLQHDWLRQLQYHVWLJDWLRQDVSUHSDUHGE\D&RXQW\FHUWLILHGZHWODQG FRQVXOWDQWKDVEHHQSURYLGHGZLWKWKLVVXEPLVVLRQ7KHUHDUHQRSRWHQWLDO ZHWODQGVRQWKHVXEMHFWSDUFHO •$IRUPDO(FR&$7Ζ'15FRQVXOWZDVLQLWLDWHGDQGWHUPLQDWHG6HHDWWDFKHGΖ'15 FRQVXOWDQGWHUPLQDWLRQOHWWHU •7RDGGUHVVDQ\SRWHQWLDOFRQFHUQVUHODWHGWRVRLOHURVLRQGUDLQDJHDQG GHSUHVVLRQDOVWRUDJHZHKDYHLQFOXGHGD6WRUPZDWHUDQDO\VLVPHPRZLWKWKLV VXEPLVVLRQZKLFKRXWOLQHVRXUSURSRVHGDVVXPSWLRQVDQGGHVLJQDSSURDFK7KH VWRUPZDWHUDQDO\VLVPHPRGHPRQVWUDWHVWKDWLPSOHPHQWDWLRQRIWKHSURMHFWDV SURSRVHGZLOOKDYHWKHQHWHIIHFWRIGHFUHDVLQJ&1DQGVWRUPZDWHUUXQRII 7KHHVWDEOLVKPHQWPDLQWHQDQFHRURSHUDWLRQRIWKHVSHFLDOXVHVKDOOQRWEH GHWULPHQWDOWRRUHQGDQJHUWKHSXEOLFKHDOWKVDIHW\PRUDOVFRPIRUWRUJHQHUDO ZHOIDUHRIWKHQHLJKERULQJYLFLQLW\ •7KLVGHYHORSPHQWDVSURSRVHGZLOOQRWLPSHGHWKHGHYHORSPHQWRIDGMDFHQW SURSHUWLHVIRUXVHVDOUHDG\SHUPLWWHGLQWKHDGMDFHQW$=RQLQJ'LVWULFWV •7KHVLWHLVORFDWHGLQDQDUHDZLWKYHU\ORZSRSXODWLRQGHQVLW\DQGLVQRW DQWLFLSDWHGWRDIIHFWWKHSXEOLFȇVFRPIRUWRUZHOIDUH •7KHSURMHFWDUHDZLOOEHVHFXUHGZLWKDIRRWIHQFHWRSURYLGHVDIHW\DQG SUHYHQWXQLQWHQGHGDFFHVV •$WPLQLPXPEHQHILWVWRWKHSXEOLFIURPFRPPXQLW\VRODULQFOXGHHQKDQFHG JULGVWDELOLW\LQFUHDVHGWD[EDVHORZHUHQHUJ\FRVWVDQGDQRSSRUWXQLW\WR FRQWULEXWHWRUHGXFHGJUHHQKRXVHJDVHPLVVLRQV •7KHWUDQVIRUPHULVWKHJUHDWHVWVRXUFHRIQRLVHRQWKHSURSHUW\$VSURSRVHG WKHWUDQVIRUPHULVDSSUR[LPDWHO\ IHHWVRXWKRIWKHQHDUHVWUHVLGHQFH ORFDWHGRQ%HHFKHU5RDG$WDGLVWDQFHRIDSSUR[LPDWHO\IWWKHQRLVH 7HFKQRORJ\'ULYH6XLWH /RZHOO0$ QHZOHDIHQHUJ\FRP JHQHUDWHGE\HDFKWUDQVIRUPHU G% ZRXOGEHQRJUHDWHUWKDQWKDWRI DPELHQWQRLVHFRPSDUDEOHWRWKHVRXQGRIDZKLVSHU •&RXQW\UHVLGHQWVDQGWKHORFDOUHJLRQZLOOEHQHILWIURPWKLVSURSRVHGVRODUIDUP GHYHORSPHQWWKURXJKUHFHLSWRILQFUHDVHGWD[UHYHQXHVORFDOMRERSSRUWXQLWLHV HQKDQFHGSRZHUJULGVWDELOLW\DQGWKHRSSRUWXQLW\WRUHGXFHPRQH\RQWKHLU HOHFWULFELOOVVKRXOGWKH\FKRRVHWRVXEVFULEHWRWKHFRPPXQLW\VRODUSURJUDP ΖQDEURDGHUVHQVHLQVWDOODWLRQRIUHQHZDEOHVRODUHQHUJ\LQWKHIRUPRID FRPPXQLW\VRODUIDUPZLOOUHGXFHWKHDPRXQWRIHQHUJ\GHSHQGHQFHRQIRVVLO IXHOVZKLFKLQWXUQUHGXFHVJUHHQKRXVHJDVHV 7KHVSHFLDOXVHZLOOQRWEHLQMXULRXVWRWKHXVHDQGHQMR\PHQWRIRWKHUSURSHUW\LQ WKHLPPHGLDWHYLFLQLW\IRUWKHSXUSRVHDOUHDG\SHUPLWWHGQRUVXEVWDQWLDOO\GLPLQLVK DQG LPSDLU SURSHUW\ YDOXHV ZLWKLQ WKH QHLJKERUKRRG DQG ZLOO EHORFDWHG DQG RSHUDWHGWRPLQLPL]HLQFRPSDWLELOLW\ZLWKWKHFKDUDFWHURIWKHVXUURXQGLQJDUHDDQG WRPLQLPL]HWKHHIIHFWRQWKHYDOXHRIWKHVXUURXQGLQJSURSHUW\ •7KHSURSRVHGFRPPXQLW\VRODUIDUPLVDTXLHWQHLJKERUDQGDORZLPSDFWXVH ZKLFKRQFHEXLOWKDVQRRQVLWHHPSOR\HHVDQGZLOOQRWDGGWRQHLJKERUKRRG WUDIILF 7KHDGHTXDWHXWLOLWLHVDFFHVVURDGVGUDLQDJHDQGRURWKHUQHFHVVDU\IDFLOLWLHVKDYH EHHQRUDUHEHLQJSURYLGHG •7KHSURSRVHGVRODUGHYHORSPHQWGRHVQRWUHTXLUHDFFHVVWRWUDGLWLRQDOXWLOLWLHV VXFK DV QDWXUDO JDV ZDWHU RU VDQLWDU\ VHZHU 7KH URXWLQJ RI WKH HOHFWULFDO LQIUDVWUXFWXUHUHTXLUHGWRFRQQHFWWRWKH&RP(GHOHFWULFV\VWHPLVVKRZQRQWKH HQFORVHGSODQV •7KHSURSRVHGVRODUIDUPZLOOQRWUHTXLUHDGGLWLRQDOSXEOLFH[SHQVHIRUILUH SURWHFWLRQUHVFXHRUUHOLHI6RODUIDUPGHYHORSPHQWGRHVQRWSUHVHQWDQ LQFUHDVHGRULQKHUHQWULVNIURPILUH6RODUSDQHOVDQGFRPSRQHQWVDUHQRW LQKHUHQWO\IODPPDEOHQRUGRWKH\SUHVHQWDQLQFUHDVHGULVNIURPILUHRURWKHU GDQJHUV 7KHDGHTXDWHPHDVXUHVKDYHEHHQRUZLOOEHWDNHQWRSURYLGHLQJUHVVDQGHJUHVV VRGHVLJQHGDVWRPLQLPL]HWUDIILFFRQJHVWLRQDQGKD]DUGRQWKHSXEOLFVWUHHWV •'XULQJWKHLQLWLDOFRQVWUXFWLRQWLPHIUDPHRIDSSUR[LPDWHO\IRXUWRVL[PRQWKV WKHUHZLOOEHDPL[RIWUXFNVUDQJLQJIURPVHPLVIRUSDQHODQGUDFNLQJGHOLYHU\ IODWEHGWUXFNVIRUIHQFLQJGXPSWUXFNVIRUGULYHZD\JUDYHODQGYDULRXVGHOLYHU\ W\SHWUXFNVDYHUDJLQJSHUGD\0DQ\RIWKHPDMRUPDWHULDOVVXSSOLHUVWUDYHO 7HFKQRORJ\'ULYH6XLWH /RZHOO0$ QHZOHDIHQHUJ\FRP IURPDOORYHUWKHFRXQWU\DQGWKHLUDUULYDOWLPHVDUHIOXLG%DVHGRQPXFKRI ZKDWLVGHVFULEHGDERYHDQGOLPLWHGDUHDRQVLWHIRUSDUNLQJPXOWLSOHWUXFNV DORQJZLWKWKHH[SHFWHGGHOLYHU\WLPHVZHKDYHGHYHORSHGWHPSRUDU\RQVLWH ORFDWLRQVIRUWUXFNVWDJLQJ$FFHVVWRWKHVLWHZLOOEHDYDLODEOHHDFKGD\GXULQJ ZRUNKRXUV DP SP:HZLOOEHDEOHWRDFFRPPRGDWHDVPDQ\DVILYH WUDFWRUWUDLOHUWUXFNVRQVLWHIRUGHOLYHULHV$Q\WUXFNWKDWZLOOQRWEHRII ORDGHGZLOOQRWEHDOORZHGWRLGOHIRUPRUHWKDQILYHPLQXWHV1RLGOLQJVLJQ V ZLOOEHSODFHGDWDSSURSULDWHORFDWLRQVΖQDGGLWLRQWRPDWHULDODQGHTXLSPHQW GHOLYHULHVZRUNHUVZLOOEHDUULYLQJWRWKHVLWHHDFKZHHNGD\XVLQJSHUVRQDO YHKLFOHV)RUVLPLODUSURMHFWVRIWKLVVFDOHDSSUR[LPDWHO\SHUVRQDOYHKLFOHV PD\EHRQVLWHDWRQHWLPH7KHVHYHKLFOHVZLOODUULYHHDFKGD\LQWKHPRUQLQJ DQGOHDYHLQWKHDIWHUQRRQ7KHWRWDOQXPEHURIYHKLFOHVRQVLWHZLOOIOXFWXDWH GHSHQGLQJRQWKHSKDVHRIWKHSURMHFW •2QFHFRQVWUXFWLRQLVFRPSOHWHWKHUHZLOOEHOLWWOHWRQRWUDIILFWRIURPWKHVLWH RWKHUWKDQIRURFFDVLRQDOPDLQWHQDQFHYLVLWVWRWLPHVSHU\HDU 7KHHVWDEOLVKPHQWRIWKHVSHFLDOXVHZLOOQRWLPSHGHWKHQRUPDODQGRUGHUO\ GHYHORSPHQWDQGLPSURYHPHQWRIVXUURXQGLQJSURSHUW\IRUXVHVSHUPLWWHGLQWKH GLVWULFW •2QFHFRQVWUXFWHGWKHVRODUIDUPZLOOILWZHOOZLWKLQWKHVXUURXQGLQJORZGHQVLW\ DJULFXOWXUDOXVHVDQGWKHSURSHUW\ZLOOQRWEHRFFXSLHGPRUHWKDQWLPHV GXULQJWKH\HDUIRUPDLQWHQDQFHYLVLWV •7KHSURSRVHGORFDWLRQRIWKHVRODUILHOGLVDVLJQLILFDQWGLVWDQFHIURPDQ\ H[LVWLQJUHVLGHQWLDOXVHV &RQVLGHUDWLRQLVJLYHQWRDQ\VSHFLDOIDFLOLWLHVVXFKDVFKXUFKHVVFKRROVRU KRVSLWDOVORFDWHGQHDUWKHSURSRVHGVSHFLDOXVH •7KHSURSRVHGVRODUIDUPVKRXOGQRWKDYHDQ\DGYHUVHLPSDFWWRDQ\VSHFLDO IDFLOLW\ 7KDQN\RX &'HDQ6PLWK3( &LYLO(QJLQHHULQJ/HDG PLAN COUNCIL AGENDA Thursday, December 8, 2022 9:00 a.m. City Hall Conference Room Remote Access via Zoom 1. Minutes for approval: November 10, 2022 2. PZC 2022-24 New Leaf Energy - Solar Farm– Annexation, Rezoning and Special Use Request Adjournment United City of Yorkville 800 Game Farm Road Yorkville, Illinois 60560 Telephone: 630-553-4350 Fax: 630-553-7575 DRAFT Page 1 of 3 UNITED CITY OF YORKVILLE PLAN COUNCIL Thursday, November 10, 2022 9:00am Yorkville City Hall, Council Chambers 800 Game Farm Road, Yorkville, Il Note: In accordance with Public Act 101-0640 and Gubernatorial Disaster Proclamation issued by Governor Pritzker pursuant to the powers vested in the Governor under the Illinois Emergency Management Act, remote attendance was allowed for this meeting to encourage social distancing due to the current Covid-19 pandemic. IN ATTENDANCE: Krysti Barksdale Noble, Community Development Director, City of Yorkville/electronic attendance Jason Engberg, Senior Planner, City of Yorkville/in-person attendance Brad Sanderson, Engineer for City of Yorkville/EEI/electronic attendance Tom Bowman, T.A. Bowman Constructors/TBK Properties/in-person attendance Jake Victor, Northpointe Development/electronic attendance Mike Belke, T.A. Bowman Constructors/electronic attendance Dave Toberman/electronic attendance Mr. Engberg called the meeting to order at 9:00am. 1. Minutes for Approval: July 14, 2022 The minutes were approved as presented. 2. PZC 2022-22 Bowman Subdivision – Final Plat of Subdivision, Variance Request All meeting attendees introduced themselves. Mr. Engberg began the discussion and said Mr. Bowman is dividing his property into 3 parcels. Measurements had been provided and Mr. Bowman was also asked to show the rear setback line. Bulk Regulations and Building Height: Mr. Engberg said in the R-1 district, the maximum height is 30 feet or a maximum of 2.5 stories, but a variance may be requested. Mr. Bowman said the property is severely sloped and they will use a 2.5 story walkout on the street side. The unit on lot 3 is on a corner and they would do a walkout to stay under 3 stories. Sidewalks are required from the developer. Lot Size: The minimum lot size is 1,800 square feet. Lot Coverage: Maximum is 50% and the developer is planning on a small footprint, while saving landscaping/vegetation. Lot Width: The width is 100 feet and 97 feet is the maximum resulting in a 3% reduction in the lot width and request for a variance. This will be decided at a Public Hearing at PZC and the final plat will Page 2 of 3 go to City Council. Mr. Bowman added that there is a 30 foot tall retaining wall on the south edge that is 97 foot and that wall is more than 3 foot away from lot line essentially giving 100 feet. That point will be brought up at EDC and PZC. Plat Requirement: More info is needed on the plat of subdivision. Building Permit Fees: A fee sheet had been given to Mr. Bowman and Ms. Noble noted a correction that there is no county road fee. She said surrounding communities would have to adopt before the fee is put into place. Landscaping: Ms. Noble said the submittal must be done before a building permit is issued. It must address parkway trees and she explained other tree requirements Mr. Bowman noted the property is already heavily wooded. Other Discussion: Mr. Sanderson said their surveyor can be contacted to obtain the necessary certificates. The right-of- way requirements along Van Emmon were discussed and Mr. Bowman asked for some clarification on the measurements and uses of the right-of-way. Mr. Bowman noted that the measurement explanations will radically change their plans. Mr. Bowman and the surveyor will discuss this prior to moving this plan forward to other city committees. Mr. Engberg noted that Mr. Bowman can either re-subdivide or rezone the property to R-2 instead of doing the variance process. A Public Hearing will still be required. Due to a poor Zoom connection, Mr. Bowman and Mr. Sanderson will meet separately and a decision will be made on a variance or rezoning. Mr. Bowman briefly touched on the sanitary system and said they were planning on connecting to the manhole on Van Emmon and noted that a grinder pump will need to be in the manhole due to grades and nearby culverts. Mr. Sanderson asked that a sketch be sent to him. Mr. Engberg said the subdivision to the south, Kendallwood Estates, has been re-named Timber Ridge Estates. Consequently, all street names have been changed as well. A summary will be provided by Mr. Engberg after the meeting. 3. PZC 2022-23 Northpointe Development – Rezoning and Variance Request This is a rezoning and variance request. Mr. Engberg said staff has received the application with site plan, elevations, trip generations etc. There are 45 condo units and the developer is seeking to rezone from B-3 to R-4 and seeking a variance to increase maximum density in the R-4 district from 8 to 13 dwelling units per acre. Bulk Regulations: Staff requested setbacks be shown on the site plan. Ms. Noble said that the entrance must face a public road which is either Rt. 34 or Sycamore and she recommended the front entrance be on Sycamore. Building Height: In R-4 zoning, the height limit is 3 story/40 feet for dwelling units. Staff asked that the overall height of the building be noted on the documents. Lot Coverage: In R-4 zoning, lot coverage is 70% and staff said the plan looked fine, but they asked the developer to include an impervious cover table. Page 3 of 3 Density: The petitioner is requesting a variance for density. They currently have 8 dwelling units per acre which is about 27 units, but are requesting 45 units or 13 dwelling units per acre. Mr. Engberg noted this is similar to St. Anthony's Place approved in 2016 and staff has no objection at this time. He noted the city is doing a Unified Development Ordinance project which may modify the regulations. Land Use: The Comp Plan calls for neighborhood retail. The developer is looking for more dense residential so it conflicts with the Plan. However, an October public meeting and community project indicates a need for senior living with amenities nearby. This location is a very good spot that aligns with the meeting views. Parking: The plan shows 93 spaces which meets the requirements of 2 per unit. Mr. Engberg said this could be considered elderly housing depending on the age requirements or restrictions. He said elderly housing is not defined in the code at the moment. He noted that Fox Hill residents will likely question the amount of traffic to be generated. Signage: The maximum monument sign size is 32 sq. ft. If a larger sign is desired, the sign variance process may be used, but Mr. Victor noted the sign will meet the code. Appearance Code: The elevations submitted are fine, but the amount of masonry and siding will require calculations to show the developer meets the code. Stormwater Detention: No detention is shown on the site plan, however, Mr. Sanderson said the detention to the southeast is adequate for this site. Refuse Container: The zoning code requires screening on all 4 sides with opaque fence on the 3rd side. Comments from Ms. Barksdale-Noble: Regarding circulation, all the aisle widths and stall lengths need to be shown. Building Elevations: Staff may ask for material samples or for detail to be shown on the architectural elevations. Lighting: A photometric plan and landscape plan will be needed. Economic Incentive Request: If the developer is seeking a city rental assistance program, the developer will contact Ms. Noble. This moves forward to EDC in December and a public meeting will also be held in December. It will not go to Public Hearing until June or July. Information about this project will also be placed on the city website. There was no further business and the meeting adjourned at 9:47am. Minutes respectfully transcribed by Marlys Young, Minute Taker/in-person attendance I have reviewed the applications for Annexation, Rezoning and Special Use request dated November 8, 2022 as submitted by C. Dean Smith on behalf of New Leaf Energy dba Beecher Solar 1, LLC, petitioner. The petitioner is seeking to construct a 5-megawatt (MW) alternating current (AC) freestanding community solar farm. As part of the request, the petitioner is seeking to annex approximately 48 acres of unincorporated agricultural land consisting of three (3) parcels #02-18-400-005, #02-18-400-006, and #02- 17-300-002. The proposed solar farm will be situated on approximately 18.44 acres of theexisting farmland parcel located immediately north of the BNSF railroad line and east of Beecher Road. The petitioner is seeking rezoning upon annexation from the City’s default R-1 Single Family Suburban Residential zoning to the A-1 Agricultural zoning district. Based upon my review of the application documents and preliminary plans, I have compiled the following comments (requests to the petitioner are underlined): ANNEXATION COMMENTS: 1. Proposed request seeks annexation of three (3) unincorporated parcels, #02-18-400-005, #02-18- 400-006, and #02-17-300-002, totaling approximately 48 acres for the purpose of constructing and operating a community solar farm on approximately 19 acres of the annexed area. 2. Annexation is contingent upon City Council approval of a requested rezoning to A-1 Agricultural District and special use authorization for the solar farm. 3. A draft annexation agreement has been provided for petitioner’s review and comment. REZONING COMMENTS: 1. Per Section 10-5-5: Zoning of Annexed Land of the United City of Yorkville’s Zoning Ordinance states, “Any territory or land hereafter annexed to the City shall automatically, upon such annexation, be classified within the R-1 residential district and be subject to all conditions and regulations applicable to land in such district until such land is subsequently rezoned”. a. Therefore, the petitioner is seeking rezoning within the A-1 Agricultural District. b. This zoning classification would permit the continued farm use on the remainder of the annexed land. 2.Per Table 10.06.07 Alternative Energy Uses of the United City of Yorkville’s Zoning Ordinance, solar farms are special uses in the A-1 Agricultural District, OS-1 Open Space (Passive), OS-2 (Active) and O-Office District. a. Solar Farms are not permitted as an authorized or special use in the R-1 Single-Family Suburban Residence District. SPECIAL USE COMMENTS: Zoning The subject property is currently located in unincorporated Kendall County. The following are the current immediate surrounding zoning and land uses: Memorandum To: Plan Council From: Krysti J. Barksdale-Noble, Community Development Director Date: November 21, 2022 Subject: PZC 2022-24 New Leaf Energy – Solar Farm Annexation, Rezoning and Special Use Zoning Land Use North A-1 Special Use (Kendall County) Agriculture (Special Use approved for sanitary landfill in 1963) South A-1 Special Use (Kendall County) Agriculture/ BNSF Railroad East R-2 Single-Family Traditional Residence District Whispering Meadows Subdivision West M-2 General Manufacturing District Lincoln Prairie (South) Beecher Road x The proposed community solar farm will consist of approximately 9,700 arrays totaling about 36,500 linear feet of racking. The system will include two (2) inverters and two (2) transformers with four (4) tracker motors. x The petitioner will enter into a twenty (20) year lease with the property owner to operate the proposed community solar farm. The lese also has an option to extend the lease term for up to four (4) additional and successive periods of five (5) years each. Location on Site Table 10.07.01 of Chapter 7 in the City’s Zoning Ordinance provides dimensions and bulk regulations for the A-1 Agricultural District. The following compares the yard setbacks required for the A-1 Agricultural District and the proposed solar farm use: Minimum Requirement Proposed Setback Front (West) 100 feet 150 feet (fence)/183 feet (solar array) Rear (East) None 157 feet (solar array) Side (North) 50 feet 50 feet (solar array) Side (South) 50 feet 91 feet (solar array) x Staff has identified the west property line (adjacent to Beecher Road) as the front property line, per Section 10-2-3: Definitions of the United City of Yorkville’s Zoning ordinance which establishes the lot line which abuts a street shall be the front lot line. x Note: Page 2 of the Project Narrative dated November 8, 2022 references “County setback requirements”. This should be revised and resubmitted with correct City regulation references. Height The maximum structure height in the A-1 Agricultural District is eighty (80) feet. Additionally, as stated in Section 10-19-7-D of the City’s Zoning Ordinance, the minimum clearance between the lowest point of the system and the surface which the system is mounted is ten (10) feet. Section 10-19-7-F states the maximum height will be stipulated as a special use condition. x The petitioner’s exhibit (Sheet C-4.0 Civil Details) appears to indicate a maximum solar array height as 94 inches (approx. 8 feet) at maximum tilt. Please verify. o In Project Narrative it states, “PV solar panel arrays at maximum 8 ft. in height with trackers/racking/string inverters. Please see sample photo on the last page of this narrative.” No photo was provided. x The petitioner’s exhibit (Sheet C-4.0 Civil Details) appears to indicate a minimum solar array clearance as 32 feet. Please verify. Glare/Lighting Section 10-19-7-E states solar panels shall be placed such that concentrated solar radiation or glare shall not be directed onto nearby properties or roadways. The panels shall be placed to face east and rotate west to follow the path of the sun to collect the most sunlight throughout the day. x Petitioner shall provide information regarding glare of proposed solar array. Petitioner states one (1) motion-sensor security light will be provided at each of the two (2) transformer areas. The proposed light standard will be between 7 feet – 9 feet in overall height. x Staff defers to the City Engineer if a photometric plan is required. Noise Per the petitioner’s project summary, the transformer is the greatest source of noise on the property. As proposed, the transformer is approximately 790 feet south of the nearest residence located on Beecher Road. x At 500 feet, the noise generated by each transformer is 21 decibels. x Noise levels measured at the property line will not exceed fifty (50) decibels. Fencing The petitioner has proposed a seven (7) foot security galvanized chain link fence to surround the perimeter of the solar farm. As stated in Section 10-17-2-G, Fence Regulations for Industrial Districts of the Zoning Ordinance, states that a fence may be a maximum of eight (8) feet in height. This section of the code also states that chain link is a permitted material. x The fencing will include a gated main entry with a total of ten (10) 4-foot gates and one (1) 20-foot gate for vehicle access. x A Knox box and keys shall be provided to the City’s building department and Bristol Kendall Fire District (BKFD). Access Road The proposed site access is via a new 20-ft. wide gravel driveway proposed off Beecher Road. x The path provides access to the equipment, however, no formal parking stalls are provided, as no buildings, employees are planned on the site except for the occasional mowing or maintenance visits, about 3-4 times per year. x Gravel roads are not permitted for vehicle travel; however, staff notes the road will have the top 4” CA-6 compacted, the next 8” CA-1 compacted with a compacted subgrade. Therefore, staff defers to the City Public Works Director and City Engineer for comment on the road composition. Decommissioning Estimate/Plan The petitioner has provided a decommission plan and construction estimate of $283,078.11 at year 25 with a 2% annual inflation rate. x Staff defers to the City Engineer for review and approval of plan and estimate. Accessory Use Section 10-19-4-D states that alternative energy systems shall be an accessory to the principal permitted use. The proposed solar farm will be accessory to the existing agricultural/farming land use, as only portion of the overall land is proposed for the community solar farm use (approx.18.44 acres of 48 acres or 38%). Signage Section 10-19-4-F states that no commercial signage or attention getting device is permitted on any alternative energy system. The submitted plans do not indicate any signage will be located on the solar farm or the surrounding fence. x Per Section 10-19-4-F states one (1) sign shall be permitted to indicate emergency contact information of the property owner or operator not to exceed two (2) square feet in area. Landscaping While perimeter landscaping is not required for solar farm uses, the petitioner indicates landscaping material (trees along eastern and southern boundaries) on the site plan. x The petitioner does note in the project narrative that “post-construction site area will be seeded with a low-mow seed mix and a weed/grass control plan.” x If a landscape plan is proposed for the perimeter of the solar farm, staff asks for details as an exhibit. Utilities The proposed community solar farm will not require public utilities such as water or sanitary sewer. The routing of the electrical infrastructure required to connect to the ComEd system appears to include an overhead wire connection near the entrance of Beecher Road. Utility Service Provider Section 10-19-4-G states that evidence that the electric utility service provider that serves the proposed site has been notified of the owner’s intent to install an interconnected customer owned electricity generator. x The petitioner has provided a copy of an Interconnection Agreement, as prepared by ComEd dated 06/07/2022. Special Use Standards Section 10-19-4-C and 10-4-9-F state specific standards for special use which all recommendation bodies will review. The petitioner has provided answers to each of the criteria in the application as well as providing an additional attachment to these standards. ϱϱdĞĐŚŶŽůŽŐLJƌŝǀĞ͕^ƵŝƚĞϭϬϮ >ŽǁĞůů͕DϬϭϴϱϭ ŶĞǁůĞĂĨĞŶĞƌŐLJ͘ĐŽŵ '$7( 'HFHPEHU 72 .U\VWL%DUNVGDOH1REOH &RPPXQLW\'HYHORSPHQW 8QLWHG&LW\RI<RUNYLOOH *DPH)DUP5RDG <RUNYLOOHΖ/ Z ͗&RPPHQW5HVSRQVH/HWWHU %HHFKHU6RODU//& 3URSRVHG*URXQG0RXQWHG6RODU)DUP %HHFKHU5RDG.HQGDOO&RXQW\ 3Ζ1 tĞŽĨĨĞƌƚŚĞĨŽůůŽǁŝŶŐŝŶĨŽƌŵĂƚŝŽŶŝŶƌĞƐƉŽŶƐĞƚŽƚŚĞĐŽŵŵĞŶƚƐƉƌŽǀŝĚĞĚĨƌŽŵŽŵŵƵŶŝƚLJĞǀĞůŽƉŵĞŶƚ ŝƌĞĐƚŽƌ͕<ƌLJƐƚŝ:͘ĂƌŬƐĚĂůĞͲEŽďůĞ͕ĚĂƚĞĚEŽǀĞŵďĞƌϮϭ͕ϮϬϮϮ͘ŽŵŵĞŶƚƐĂƌĞŝŶƵŶĚĞƌůŝŶĞĚƚĞdžƚĂŶĚ ƌĞƐƉŽŶƐĞƐĂƌĞŝŶďŽůĚƚĞdžƚďĞůŽǁ͘ ĞǀĞůŽƉŵĞŶƚĞƉĂƌƚŵĞŶƚŽŵŵĞŶƚƐ͗ 1RWH 3DJHRIWKH3URMHFW1DUUDWLYHGDWHG1RYHPEHUUHIHUHQFHV³&RXQW\VHWEDFN UHTXLUHPHQWV´7KLVVKRXOGEHUHYLVHGDQGUHVXEPLWWHGZLWKFRUUHFW&LW\UHJXODWLRQUHIHUHQFHV 1/(5HVSRQVH 7KHHUURUKDVEHHQFRUUHFWHGLQWKH3URMHFW1DUUDWLYH 7KHSHWLWLRQHU¶VH[KLELW 6KHHW&&LYLO'HWDLOV DSSHDUVWRLQGLFDWHDPD[LPXPVRODUDUUD\ KHLJKWDV LQFKHV DSSUR[IHHW DWPD[LPXPWLOW3OHDVHYHULI\ 1/(5HVSRQVH 7KHPD[LPXPVRODUDUUD\KHLJKWLV LQFKHVDWPD[LPXPWLOWIRUWKH $7, UDFNLQJ V\VWHP 7KHUH LV D SRVVLELOLW\ WKDW D GLIIHUHQW UDFNLQJ V\VWHP ZLOO EH VSHFLILHGDWWKHWLPHRIFRQVWUXFWLRQ:HKDYHDWWDFKHGDGHWDLORIWKH7HUUDWUDNUDFNLQJ V\VWHPWKDWKDVDPD[LPXPKHLJKWRIIHHW,WZRXOGEHDGYLVDEOHWROLVWWKDWDVWKH PD[LPXPSRWHQWLDOKHLJKWRIWKHV\VWHP ,Q 3URMHFW 1DUUDWLYH LW VWDWHV ³39 VRODU SDQHO DUUD\V DW PD[LPXP IW LQ KHLJKW ZLWK WUDFNHUVUDFNLQJVWULQJLQYHUWHUV3OHDVHVHHVDPSOHSKRWRRQWKHODVWSDJHRIWKLVQDUUDWLYH´1R SKRWRZDVSURYLGHG 1/(5HVSRQVH 7KHHUURUKDVEHHQUHPRYHGIURPWKH3URMHFW1DUUDWLYH 7KHSHWLWLRQHU¶VH[KLELW 6KHHW&&LYLO'HWDLOV DSSHDUVWRLQGLFDWHDPLQLPXPVRODU DUUD\FOHDUDQFHDVIHHW3OHDVHYHULI\ 1/(5HVSRQVH 7KHPLQLPXPVRODUDUUD\FOHDUDQFHLVLQFKHVIRUWKH$7,UDFNLQJ ϱϱdĞĐŚŶŽůŽŐLJƌŝǀĞ͕^ƵŝƚĞϭϬϮ >ŽǁĞůů͕DϬϭϴϱϭ ŶĞǁůĞĂĨĞŶĞƌŐLJ͘ĐŽŵ V\VWHP7KHUHLVDSRVVLELOLW\WKDWDGLIIHUHQWUDFNLQJV\VWHPZLOOEHVSHFLILHGDWWKHWLPH RIFRQVWUXFWLRQ:HKDYHDWWDFKHGDGHWDLORIWKH7HUUDWUDNUDFNLQJV\VWHPWKDWKDVD PLQLPXPJURXQGFOHDUDQFHRILQFKHV 3HWLWLRQHUVKDOOSURYLGHLQIRUPDWLRQUHJDUGLQJJODUHRISURSRVHGVRODUDUUD\ 1/(5HVSRQVH $JODUHDQDO\VLVKDVEHHQSURYLGHGLQWKHVXEPLVVLRQ7KHUHVXOWVRIWKH DQDO\VLVVKRZQRSRWHQWLDOIRUSUREOHPJODUH 6WDIIGHIHUVWRWKH&LW\(QJLQHHULIDSKRWRPHWULFSODQLVUHTXLUHG 1/(5HVSRQVH $SKRWRPHWULFSODQZLOOEHVXEPLWWHGZLWKWKH)LQDO(QJLQHHULQJ3ODQV $.QR[ER[DQGNH\VVKDOOEHSURYLGHGWRWKH&LW\¶VEXLOGLQJGHSDUWPHQWDQG%ULVWRO .HQGDOO)LUH'LVWULFW %.)' 1/(5HVSRQVH 7KLVLQIRUPDWLRQKDVEHHQDGGHGWRWKH3URMHFW1DUUDWLYH7KHUHZLOOEH QRSUREOHPZLWKSURYLGLQJHQWU\IRUHPHUJHQF\VHUYLFHV 7KHUHIRUHVWDIIGHIHUVWRWKH&LW\3XEOLF:RUNV'LUHFWRUDQG&LW\(QJLQHHUIRUFRPPHQWRQ WKHURDGFRPSRVLWLRQ 1/(5HVSRQVH 1/(ZLOOZRUNZLWKWKH&LW\3XEOLF:RUNV'LUHFWRUDQG&LW\(QJLQHHU RQWKHURDGFRPSRVLWLRQ 6WDIIGHIHUVWRWKH&LW\(QJLQHHUIRUUHYLHZDQGDSSURYDORISODQDQGHVWLPDWH 1/(5HVSRQVH 1/(ZLOOZRUNZLWKWKH&LW\(QJLQHHURQWKH'HFRPPLVVLRQLQJ (VWLPDWH 3HU6HFWLRQ )VWDWHVRQH VLJQVKDOOEHSHUPLWWHGWRLQGLFDWHHPHUJHQF\FRQWDFW LQIRUPDWLRQRIWKHSURSHUW\RZQHURURSHUDWRUQRWWRH[FHHGWZR VTXDUHIHHWLQDUHD 1/(5HVSRQVH $QHPHUJHQF\FRQWDFWLQIRUPDWLRQVLJQGHWDLOKDVEHHQDGGHGWR6KHHW &&LYLO'HWDLOV ,IDODQGVFDSHSODQLVSURSRVHGIRUWKHSHULPHWHURIWKHVRODUIDUPVWDIIDVNVIRUGHWDLOVDVDQ H[KLELW 1/(5HVSRQVH $ODQGVFDSLQJSODQZLOOEHVXEPLWWHGZLWKWKH)LQDO(QJLQHHULQJ3ODQV ŝƚLJ ŶŐŝŶĞĞƌŽŵŵĞŶƚƐ͗ 7KHIROORZLQJSHUPLWVPD\EHUHTXLUHGGXULQJILQDOHQJLQHHULQJDQGVKRXOGEHSURYLGHGWR WKH&LW\ZKHQREWDLQHG7KH&LW\DQG((,VKRXOGEHFRSLHGRQDOOFRUUHVSRQGHQFHZLWKWKH DJHQFLHV •,(3$13'(6*HQHUDO&RQVWUXFWLRQ3HUPLWLVUHTXLUHG7KH1RWLFHRI,QWHQWPXVW EHILOHGZLWK,(3$GD\VSULRUWRVWDUWRIFRQVWUXFWLRQ •86$&(-XULVGLFWLRQDO'HWHUPLQDWLRQRIZHWODQGV •6WRUPZDWHUSHUPLWDSSOLFDWLRQLQDFFRUGDQFHZLWKWKH<RUNYLOOH6WRUP:DWHU 0DQDJHPHQW2UGLQDQFH .HQGDOO&RXQW\ZLGH2UGLQDQFH 1/(5HVSRQVH 1RWHGDOOUHTXLUHGORFDOVWDWHDQGIHGHUDOSHUPLWVUHTXLUHGIRU FRQVWUXFWLRQZLOOEHREWDLQHG 7KHIROORZLQJZLOOQHHGWREHVXEPLWWHGZLWK)LQDO(QJLQHHU3ODQV ϱϱdĞĐŚŶŽůŽŐLJƌŝǀĞ͕^ƵŝƚĞϭϬϮ >ŽǁĞůů͕DϬϭϴϱϭ ŶĞǁůĞĂĨĞŶĞƌŐLJ͘ĐŽŵ D7UXFNWXUQLQJH[KLELWVIRUGHOLYHU\DQGHPHUJHQF\YHKLFOHV E/DQGVFDSHSODQ F3KRWRPHWULFSODQ 1/(5HVSRQVH 1/(ZLOOVXEPLWWKHIROORZLQJSODQVZLWK)LQDO(QJLQHHU3ODQV 7KHUHLVDIORRGSODLQRQWKHSURSHUW\DVVRFLDWHGZLWK5RE5R\&UHHNWKDWZDV LGHQWLILHGLQWKH,QWHULP+\GURORJLF +\GUDXOLF$QDO\VLVRI5RE5R\&UHHN 7KHSURSHUW\ZLOOKDYHWREHGHYHORSHGLQDFFRUGDQFHZLWKWKHIORRGSODLQSURYLVLRQV RIWKH&LW\ VVWRUPZDWHURUGLQDQFH 1/( 5HVSRQVH 1/( ZLOO GHYHORS WKH SURSHUW\ LQ DFFRUGDQFH ZLWKWKH IORRGSODLQ SURYLVLRQV RI WKH &LW\¶V VWRUPZDWHU RUGLQDQFH :H KDYH VRPH TXHVWLRQVDVVRFLDWHGZLWKWKH5RE5R\&UHHN$QDO\VLVDQGZHZLOOZRUNZLWK FLW\VWDIIWRFRPSO\ 7KHOLPLWVRIWKHIORRGSODLQVKRXOGEHVKRZQRQWKHSODQV7KHIORRGSODLQHOHYDWLRQLV DSSUR[LPDWHO\IHHWDWWKHSURMHFWORFDWLRQ 1/(5HVSRQVH 7KHOLPLWVRIWKHIORRGSODLQDORQJ5RE5R\&UHHNKDYHEHHQDGGHGWR WKHSODQV:HZLOOQHHGWRZRUNZLWKFLW\VWDIIUHJDUGLQJWKHVPDOOIORRGSODLQDUHDQHDU %HHFKHU5RDG ,PSDFWVWRWKHZHWODQGVVKRXOGEHGHVLJQHGLQDFFRUGDQFHZLWKWKH8QLWHG&LW\RI<RUNYLOOH¶V :HWODQG3URWHFWLRQ5HJXODWLRQV 1/(5HVSRQVH 2QVLWHZHWODQGVDUHOLPLWHGWRWKHDUHDDGMDFHQWWR5RE5R\&UHHN ZKLFKZHKDYHDYRLGHG1/(ZLOOZRUNZLWKFLW\VWDIIWRFRQILUPRXUGHVLJQLQ DFFRUGDQFHZLWKWKH8QLWHG&LW\RI<RUNYLOOH¶V:HWODQG3URWHFWLRQ5HJXODWLRQV 7KH&LW\ZLOOUHTXLUH¶RIULJKWRIZD\GHGLFDWLRQIURPWKHSURSHUW\$SODWRIGHGLFDWLRQ GRFXPHQWZLOOQHHGWREHSUHSDUHG 1/(5HVSRQVH 7KHSURSRVHG¶ULJKWRIZD\GHGLFDWLRQLVVKRZQRQWKHSODQV7KH SODWRIGHGLFDWLRQZLOOEHSUHSDUHGE\WKHVXUYH\RUDQGEHSURYLGHGWRWKHFLW\ZKHQ REWDLQHG $PLQLPXPRID¶SXEOLFXWLOLW\HDVHPHQWDORQJWKH%HHFKHU5RDGIURQWDJHZLOO EHUHTXLUHG$¶XWLOLW\HDVHPHQWDORQJWKHUDLOURDGZLOODOVREHUHTXLUHGDORQJ ZLWKDWHPSRUDU\FRQVWUXFWLRQHDVHPHQWRI $SODQQHGVDQLWDU\VHZHULVDORQJ WKLVURXWH 1/( 5HVSRQVH 7KH SURSRVHG HDVHPHQWV DUH VKRZQ RQ WKH SODQV 7KH ¶ WHPSRUDU\FRQVWUXFWLRQHDVHPHQWHQFURDFKHVWKHVRODUDUUD\V7KHUHZLOOQHHG WREHDGLVFXVVLRQRQWKLVGHSHQGLQJRQWKHWLPLQJRIWKHQHHGIRUWKHWHPSRUDU\ FRQVWUXFWLRQHDVHPHQW 6LQFHWKHSURMHFWLVDQRQUHVLGHQWLDOGHYHORSPHQWRQPRUHWKDQDFUHVLWPXVWPHHWWKH VWRUPZDWHUGHWHQWLRQUHTXLUHPHQWVSHUWKH6WRUPZDWHU2UGLQDQFH7KHVXEPLWWHGQDUUDWLYH GHPRQVWUDWHVDUHGXFWLRQRIIORZIRUSURSRVHGYHUVXVH[LVWLQJFRQGLWLRQV KRZHYHUWKH RUGLQDQFHUHTXLUHVGHWHQWLRQFDOFXODWLRQVEDVHGRQPD[LPXPUHOHDVHUDWHVRDGGLWLRQDO FDOFXODWLRQVZLOOEHUHTXLUHG 1/(5HVSRQVH 6WRUPZDWHUPRGHOLQJLVXQGHUZD\7KHVWRUPZDWHUPRGHOLQJUHVXOWV DQGUHSRUWZLOOEHSURYLGHGDWDODWHUGDWH ϱϱdĞĐŚŶŽůŽŐLJƌŝǀĞ͕^ƵŝƚĞϭϬϮ >ŽǁĞůů͕DϬϭϴϱϭ ŶĞǁůĞĂĨĞŶĞƌŐLJ͘ĐŽŵ ,PSURYHPHQWVWR%HHFKHU5RDGPD\EHUHTXLUHG%HHFKHU5RDGLVFXUUHQWO\QRWFRQVWUXFWHG WR&LW\VWDQGDUGV 1/(5HVSRQVH 1/(ZLOOZRUNZLWKWKH&LW\(QJLQHHUWRUHVROYHWKLVLVVXH 7KHLQIODWLRQIRUWKHGHFRPPLVVLRQLQJHVWLPDWHLVVKRZQDW$KLJKHUYDOXHVKRXOGEH XVHG 1/(5HVSRQVH 1/(ZLOOZRUNZLWKWKH&LW\(QJLQHHUIRUDKLJKHUYDOXHHVFDODWLRQ YDOXHRQWKH'HFRPPLVVLRQLQJ(VWLPDWH 7KHGHYHORSPHQWGHSDUWPHQWVKRXOGFRPPHQWRQWKHIHQFHPDWHULDOV 1/(5HVSRQVH 1/(ZLOOZRUNZLWKWKH'HYHORSPHQW'HSDUWPHQWRQWKHIHQFH PDWHULDOV 7KHGHYHORSPHQWGHSDUWPHQWVKRXOGFRPPHQWRQWKHJUDYHOGULYHZD\ 1/(5HVSRQVH 1/(ZLOOZRUNZLWKWKH'HYHORSPHQW'HSDUWPHQWRQWKHJUDYHO GULYHZD\ dŚĂŶŬLJŽƵ͕ ͘ĞĂŶ^ŵŝƚŚ͕W ŝǀŝů ŶŐŝŶĞĞƌŝŶŐ>ĞĂĚ 77,7/(3$*(352-(&7',5(&725<352-(&76&23(*(1(5$/127(6*(1(5$/$%%5(9,$7,216/2&$7,210$3$(5,$/9,(:$33/,&$%/(&2'(6$1'67$1'$5'66,7(86(3(50,76(7%((&+(552$'.(1'$//,/ 0:$&5$7('62/$5(/(&75,&6<67(06<67(0'(6&5,37,21'5$:,1*/,67H[S (;,67,1*&21',7,2163/$1&(;,67,1*&21',7,2163/$1H[S /9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9 /9 /9/9;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;/$<287$1'0$7(5,$/63/$1&/$<287$1'0$7(5,$/63/$1H[S /9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9 /9 /9/9;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;*5$',1*$1'(526,21&21752/3/$1&*5$',1*$1'(526,21&21752/3/$1H[S &&,9,/'(7$,/6 6,/7)(1&(&21&5(7(:$6+287 0$1*$7(&+$,1/,1.)(1&(9(+,&/(*$7(9(57,&$/0281702725&/($5$1&(6/,*+7,1*02817,1*'2:1/,*+767$%,/,=('&216758&7,21(175$1&(*5$9(/$&&(6652$'(0(5*(1&<&217$&76,*1H[S /9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9/9 /9 /9/9;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;'(&200,66,21,1*3/$1&'(&200,66,21,1*3/$1H[S December 23, 2022 Krysti Barksdale-Noble Community Development United City of Yorkville 800 Game Farm Road Yorkville, IL 60560 Terratrak Detail Beecher Solar 1, LLC Proposed Ground-Mounted Solar Farm Beecher Road, Kendall County PIN# 02-18-400-005, 02-18-400-006, 02-17-300-002 FORGESOLAR GLARE ANALYSIS Summary of Results No glare predicted PV Array Tilt Orient Annual Green Glare Annual Yellow Glare Energy ° ° min hr min hr kWh PV Arrays SA tracking SA tracking 0 0.0 0 0.0 - Total annual glare received by each receptor; may include duplicate times of glare from multiple reflective surfaces. Receptor Annual Green Glare Annual Yellow Glare min hr min hr Route 1 0 0.0 0 0.0 OP 1 0 0.0 0 0.0 OP 2 0 0.0 0 0.0 OP 3 0 0.0 0 0.0 OP 4 0 0.0 0 0.0 Project: Beecher Rd - Kendall IL Proposed 5 MW Ground-Mounted Solar Farm east of Beecher Road in Yorkville, IL. Site configuration: Initial Created 20 Dec, 2022 Updated 21 Dec, 2022 Time-step 1 minute Timezone offset UTC-6 Site ID 81519.14412 Category 1 MW to 5 MW DNI peaks at 1,000.0 W/m^2 Ocular transmission coefficient 0.5 Pupil diameter 0.002 m Eye focal length 0.017 m Sun subtended angle 9.3 mrad Methodology V2 Page 1 of 5 Component Data PV Arrays Route Receptors Name: PV Arrays Axis tracking: Single-axis rotation Backtracking: Shade-slope Tracking axis orientation: 180.0° Max tracking angle: 52.0° Resting angle: 52.0° Ground Coverage Ratio: 0.43 Rated power: - Panel material: Smooth glass with AR coating Reflectivity: Vary with sun Slope error: correlate with material Vertex Latitude (°) Longitude (°) Ground elevation (ft) Height above ground (ft) Total elevation (ft) 1 41.679534 -88.471372 644.61 6.00 650.61 2 41.679679 -88.466904 640.02 6.00 646.02 3 41.678577 -88.466888 638.18 6.00 644.18 4 41.678545 -88.468138 642.76 6.00 648.76 5 41.678268 -88.468132 643.15 6.00 649.15 6 41.678204 -88.469157 644.58 6.00 650.58 7 41.677996 -88.469162 644.47 6.00 650.47 8 41.677948 -88.470530 645.37 6.00 651.37 9 41.677711 -88.470514 645.07 6.00 651.07 10 41.677679 -88.471287 643.55 6.00 649.55 Name: Route 1 Path type: Two-way Observer view angle: 50.0° Vertex Latitude (°) Longitude (°) Ground elevation (ft) Height above ground (ft) Total elevation (ft) 1 41.673862 -88.472138 644.86 5.00 649.86 2 41.685491 -88.472338 653.05 5.00 658.05 Page 2 of 5 Discrete Observation Point Receptors Name ID Latitude (°) Longitude (°) Elevation (ft) Height (ft) OP 1 1 41.680769 -88.470923 647.21 5.00 OP 2 2 41.674884 -88.471397 645.15 5.00 OP 3 3 41.678037 -88.459573 645.92 5.00 OP 4 4 41.673000 -88.472065 644.43 5.00 Page 3 of 5 Glare Analysis Results Summary of Results No glare predicted PV Array Tilt Orient Annual Green Glare Annual Yellow Glare Energy ° ° min hr min hr kWh PV Arrays SA tracking SA tracking 0 0.0 0 0.0 - Total annual glare received by each receptor; may include duplicate times of glare from multiple reflective surfaces. Receptor Annual Green Glare Annual Yellow Glare min hr min hr Route 1 0 0.0 0 0.0 OP 1 0 0.0 0 0.0 OP 2 0 0.0 0 0.0 OP 3 0 0.0 0 0.0 OP 4 0 0.0 0 0.0 PV: PV Arrays no glare found Receptor results ordered by category of glare Receptor Annual Green Glare Annual Yellow Glare min hr min hr Route 1 0 0.0 0 0.0 OP 1 0 0.0 0 0.0 OP 2 0 0.0 0 0.0 OP 3 0 0.0 0 0.0 OP 4 0 0.0 0 0.0 PV Arrays and Route 1 Receptor type: Route No glare found PV Arrays and OP 1 Receptor type: Observation Point No glare found PV Arrays and OP 2 Receptor type: Observation Point No glare found Page 4 of 5 Assumptions Default glare analysis parameters and observer eye characteristics (for reference only): • Analysis time interval: 1 minute • Ocular transmission coefficient: 0.5 • Pupil diameter: 0.002 meters • Eye focal length: 0.017 meters • Sun subtended angle: 9.3 milliradians 2016 © Sims Industries d/b/a ForgeSolar, All Rights Reserved. PV Arrays and OP 3 Receptor type: Observation Point No glare found PV Arrays and OP 4 Receptor type: Observation Point No glare found "Green" glare is glare with low potential to cause an after-image (flash blindness) when observed prior to a typical blink response time. "Yellow" glare is glare with potential to cause an after-image (flash blindness) when observed prior to a typical blink response time. Times associated with glare are denoted in Standard time. For Daylight Savings, add one hour. The algorithm does not rigorously represent the detailed geometry of a system; detailed features such as gaps between modules, variable height of the PV array, and support structures may impact actual glare results. However, we have validated our models against several systems, including a PV array causing glare to the air-traffic control tower at Manchester-Boston Regional Airport and several sites in Albuquerque, and the tool accurately predicted the occurrence and intensity of glare at different times and days of the year. Several V1 calculations utilize the PV array centroid, rather than the actual glare spot location, due to algorithm limitations. This may affect results for large PV footprints. Additional analyses of array sub-sections can provide additional information on expected glare. This primarily affects V1 analyses of path receptors. Random number computations are utilized by various steps of the annual hazard analysis algorithm. Predicted minutes of glare can vary between runs as a result. This limitation primarily affects analyses of Observation Point receptors, including ATCTs. Note that the SGHAT/ ForgeSolar methodology has always relied on an analytical, qualitative approach to accurately determine the overall hazard (i.e. green vs. yellow) of expected glare on an annual basis. The analysis does not automatically consider obstacles (either man-made or natural) between the observation points and the prescribed solar installation that may obstruct observed glare, such as trees, hills, buildings, etc. The subtended source angle (glare spot size) is constrained by the PV array footprint size. Partitioning large arrays into smaller sections will reduce the maximum potential subtended angle, potentially impacting results if actual glare spots are larger than the sub-array size. Additional analyses of the combined area of adjacent sub-arrays can provide more information on potential glare hazards. (See previous point on related limitations.) The variable direct normal irradiance (DNI) feature (if selected) scales the user-prescribed peak DNI using a typical clear-day irradiance profile. This profile has a lower DNI in the mornings and evenings and a maximum at solar noon. The scaling uses a clear-day irradiance profile based on a normalized time relative to sunrise, solar noon, and sunset, which are prescribed by a sun-position algorithm and the latitude and longitude obtained from Google maps. The actual DNI on any given day can be affected by cloud cover, atmospheric attenuation, and other environmental factors. The ocular hazard predicted by the tool depends on a number of environmental, optical, and human factors, which can be uncertain. We provide input fields and typical ranges of values for these factors so that the user can vary these parameters to see if they have an impact on the results. The speed of SGHAT allows expedited sensitivity and parametric analyses. The system output calculation is a DNI-based approximation that assumes clear, sunny skies year-round. It should not be used in place of more rigorous modeling methods. Hazard zone boundaries shown in the Glare Hazard plot are an approximation and visual aid based on aggregated research data. Actual ocular impact outcomes encompass a continuous, not discrete, spectrum. Glare locations displayed on receptor plots are approximate. Actual glare-spot locations may differ. Refer to the Help page at www.forgesolar.com/help/ for assumptions and limitations not listed here. Page 5 of 5 7HFKQRORJ\'ULYH6XLWH /RZHOO0$ QHZOHDIHQHUJ\FRP '$7( 1RYHPEHU 72 .U\VWL%DUNVGDOH1REOH &RPPXQLW\'HYHORSPHQW 8QLWHG&LW\RI<RUNYLOOH *DPH)DUP5RDG <RUNYLOOHΖ/ 5( ([KLELW$3DUFHO/HJDO'HVFULSWLRQ %HHFKHU6RODU//& 3URSRVHG*URXQG0RXQWHG6RODU)DUP %HHFKHU5RDG.HQGDOO&RXQW\ 3Ζ1 3$5&(//(*$/'(6&5Ζ37Ζ21 7+$73$572)7+(6287+:(67~2)6(&7Ζ21 3$572)7+(6287+($67~2)6(&7Ζ21$1'3$572) 7+(1257+($67~2)6(&7Ζ21 72:16+Ζ31257+5$1*(($672)7+(7+Ζ5'35Ζ1&Ζ3$/0(5Ζ'Ζ$1 '(6&5Ζ%('$6)2//2:6 &200(1&Ζ1*217+(1257+/Ζ1(2)6(&7Ζ21 $)25(6$Ζ'&+$Ζ16:(672)7+(1257+($67 &251(57+(5(2) 7+(1&(1257+'(*5((60Ζ187(66(&21'6($67&+$Ζ16727+(6287+ 5Ζ*+72):$<2)7+(&+Ζ&$*2%85/Ζ1*721$1'48Ζ1&<5$Ζ/52$'&203$1<)257+(32Ζ172) %(*Ζ11Ζ1* 7+(1&(6287+'(*5((60Ζ187(66(&21'6:(67727+(&(17(5/Ζ1(2)7+(%5Ζ672/ $1'3/$1252$' 7+(1&(6287+($67(5/<$/21*6$Ζ'&(17(5/Ζ1(727+(&(17(52)52%52<&5((. 7+(1&(1257+($67(5/<$/21*6$Ζ'&(17(5/Ζ1(727+(($67/Ζ1(2)6(&7Ζ21 7+(1&(1257+ $/21*6$Ζ'($67/Ζ1(&+$Ζ16727+(6287+:(67&251(52)6(&7Ζ21 7+(1&(($67$/21*7+( 6287+/Ζ1(2)6$Ζ'6(&7Ζ21&+$Ζ16 7+(1&(1257+($67(5/<72$32Ζ17217+(1257+/Ζ1(2) 7+(6287+:(67~2)7+(6287+:(67~2)6(&7Ζ21:+Ζ&+Ζ6&+$Ζ16($672)7+(1257+:(67 &251(52)6$Ζ'48$57(548$57(5 7+(1&(:(67$/21*7+(1257+/Ζ1(2)7+(6287+:(67~2)7+( 6287+:(67~2)6(&7Ζ21$1'$/21*7+(1257+/Ζ1(2)7+(6287+($67~2)7+(6287+($67~2) 6(&7Ζ21727+(1257+:(67&251(52)6$Ζ'6287+($67~2)7+(6287+($67 7+(1&(6287+ $/21*7+(:(67/Ζ1(2)6$Ζ'48$57(548$57(5727+(6287+5Ζ*+72):$</Ζ1(2)7+(&+Ζ&$*2 %85/Ζ1*721$1'48Ζ1&<5$Ζ/52$'&203$1< 7+(1&(:(67(5/<$/21*6$Ζ'6287+5Ζ*+72):$<72 7+(32Ζ172)%(*Ζ11Ζ1* (;&(37Ζ1*7+(5()5207+(5Ζ*+72):$<2)7+(&+Ζ&$*2%85/Ζ1*721$1' 48Ζ1&<5$Ζ/52$'&203$1< Ζ17+(72:16+Ζ32)%5Ζ672/.(1'$//&2817<Ζ//Ζ12Ζ6 7HFKQRORJ\'ULYH6XLWH /RZHOO0$ QHZOHDIHQHUJ\FRP '$7( 1RYHPEHU 72 .U\VWL%DUNVGDOH1REOH &RPPXQLW\'HYHORSPHQW 8QLWHG&LW\RI<RUNYLOOH *DPH)DUP5RDG <RUNYLOOHΖ/ 5( ([KLELW%Ȃ$GMDFHQW3URSHUW\2ZQHUV %HHFKHU6RODU//& 3URSRVHG*URXQG0RXQWHG6RODU)DUP %HHFKHU5RDG.HQGDOO&RXQW\ 3Ζ1 $'-$&(173523(57<2:1(56 .HODND//& 6/LQFROQZD\ 1RUWK$XURUDΖ/ 3LQ +DPPDQ'RQDOG- &DURO6 %)D[RQ5G 3ODQRΖ/ 3LQ :D\QH/LY7UXVW &UXLVH'HORUHV/LY7UXVW&UXLVH :DOVK'U <RUNYLOOHΖ/ 3LQ 'RORUHV/LYLQJ7UXVW&UXLVH :DON'U <RUNYLOOHΖ/ 3LQ .HODND//& 6/LQFROQZD\ 1RUWK$XURUDΖ/ 3LQ .\O\QV5LGJH+RPHRZQHUV$VVQ 32%R[ <RUNYLOOHΖ/ 3LQ <RUNYLOOH0HDGRZV//& &26KHUULH&KLRX 5HPLQJWRQ5G 6FKDXPEXUJΖ/ 3LQ <RUNYLOOH0HDGRZV//& &26KHUULH&KLRX 5HPLQJWRQ5G 6FKDXPEXUJΖ/ 3LQ <RUNYLOOH0HDGRZV//& &26KHUULH&KLRX 5HPLQJWRQ5G 6FKDXPEXUJΖ/ 3LQ 3DSHQGLFN6FRWW' :3LQH'U &DURO6WUHDPΖ/ 3LQ %6 6)5DLOZD\&R 32%R[ )RUW:RUWK7; 3LQ %6 6)5DLOZD\&R 32%R[ )RUW:RUWK7; 3LQ 7HFKQRORJ\'ULYH6XLWH /RZHOO0$ QHZOHDIHQHUJ\FRP -<-//& %HHFKHU5G <RUNYLOOHΖ/ 3LQ -<-//& %HHFKHU5G <RUNYLOOHΖ/ 3LQ &DURO6+DPPDQ0*51*+)DUPV//& %)D[RQ5G 3ODQRΖ/ 3LQ 7HFKQRORJ\'ULYH6XLWH /RZHOO0$ QHZOHDIHQHUJ\FRP '$7( 1RYHPEHU 72 .U\VWL%DUNVGDOH1REOH &RPPXQLW\'HYHORSPHQW 8QLWHG&LW\RI<RUNYLOOH *DPH)DUP5RDG <RUNYLOOHΖ/ 5( 6WRUPZDWHU1DUUDWLYH %HHFKHU6RODU//& 3URSRVHG*URXQG0RXQWHG6RODU)DUP %HHFKHU5RDG.HQGDOO&RXQW\ 3Ζ1 'HDU0UV%DUNVGDOH1REOH %HHFKHU6RODU//&FR1HZ/HDI(QHUJ\ΖQF 1HZ/HDI SODQVWRFRQVWUXFWD0: FRPPXQLW\VRODUIDFLOLW\DORQJ%HHFKHU5RDGLQ<RUNYLOOHΖ/$SURMHFWDUHDRIDSSUR[LPDWHO\ DFUHVZLOOEHDIIHFWHGE\FRQVWUXFWLRQDQGRSHUDWLRQRIWKHIDFLOLW\7KLVLQFOXGHVWKH DUHDVHQFRPSDVVHGE\DIHQFHDQGWKHDVVRFLDWHGDFFHVVURDG6HHWKHDWWDFKHG/D\RXW DQG0DWHULDOV3ODQIRUWKHORFDWLRQRIWKHV\VWHPDQGDVVRFLDWHGURDGV 7KHSURSRVHGVWRUPZDWHUPDQDJHPHQWV\VWHPIRUWKHVRODUDUUD\ILHOGLVEDVHGRQ LPSURYHGJURXQGFRYHUDVFRPSDUHGWRH[LVWLQJFRQGLWLRQVWR\LHOGDUHGXFWLRQLQ VWRUPZDWHUUXQRII&XUUHQWO\URZFURSVRFFXS\WKHH[LVWLQJGHYHORSPHQWDUHD$IWHUWKH LQVWDOODWLRQRIWKHVRODUDUUD\VJUDYHODFFHVVURDGDQGHTXLSPHQWSDGVDORZPDLQWHQDQFH VKDGHWROHUDQWVHHGPL[ 0HDGRZ ZLOOEHSODQWHGIRUJURXQGFRYHU$VGHPRQVWUDWHGE\ WKHFDOFXODWLRQVWKHFXUYHQXPEHU &1 LVJUHDWO\UHGXFHGZKLFK\LHOGVDUHGXFWLRQLQ VWRUPZDWHUUXQRIIIRUDQ\JLYHQVWRUPHYHQW 7KHVRODUDUUD\ILHOGZLOOEHGHVLJQHGWRPDWFKFXUUHQWWRSRJUDSK\ZLWKOLPLWHGJUDGLQJ SURSRVHGDWWKHWUDQVIRUPHUSDGVDQGGULYHZD\DSURQ7KHVRODUSDQHOVLQWKHDUUD\ILHOG ZLOOEHVXSSRUWHGE\SRVWVGULYHQLQWRWKHJURXQG7KHUHDUHQRFRQFUHWHIRRWLQJVRU IRXQGDWLRQVSURSRVHGWRVXSSRUWWKHVRODUDUUD\SDQHOV7KHLPSHUYLRXVIRRWSULQWIRUWKH VXSSRUWVLVQHJOLJLEOH3OHDVHQRWHWKDWWKHSURSRVHGVRODUSDQHOVZLOOURWDWHZLWKWKHVXQ XSWRILIW\WZR GHJUHHVIURPKRUL]RQWDOUHGXFLQJWKHFKDQFHRIDFRQFHQWUDWHG IORZHURVLRQDORQJDQGEHORZWKHHGJHRIWKHSDQHOV 7HFKQRORJ\'ULYH6XLWH /RZHOO0$ QHZOHDIHQHUJ\FRP 7KHIROORZLQJWDEOHGHSLFWVWKHFDOFXODWLRQVRIZHLJKWHG&1YDOXHVIRUH[LVWLQJDQG SURSRVHGFRQGLWLRQV8QGHUSURSRVHGFRQGLWLRQVWKH&1IRUWKHSURMHFWOLPLWVZLOOEH UHGXFHGIURPH[LVWLQJFRQGLWLRQV 7HFKQRORJ\'ULYH6XLWH /RZHOO0$ QHZOHDIHQHUJ\FRP ΖQDGGLWLRQWRWKHUHGXFWLRQLQVWRUPZDWHUUXQRIIWKHSURSRVHGVRODUILHOGZLOOSURYLGHDQ LPSURYHGZDWHUTXDOLW\FRQGLWLRQZLWKWKHHOLPLQDWLRQRIWKHSORZLQJWLOOLQJDQGKDUYHVWLQJ RIURZFURSV7KHUHZLOOEHQRKHUELFLGHVSHVWLFLGHVRUIHUWLOL]HUVXVHGIRUSURSRVHGORZ PDLQWHQDQFHVKDGHWROHUDQWJURXQGFRYHU6WRUPZDWHULPSDFWVUHVXOWLQJIURP FRQVWUXFWLRQDFWLYLWLHVZLOOEHDGGUHVVHGE\WKHFRQGLWLRQVRIWKHΖ/5*HQHUDO13'(6 SHUPLWDQGDVVRFLDWHG6:333DVUHTXLUHGE\WKHΖ(3$ 7KDQN\RX &'HDQ6PLWK3( &LYLO(QJLQHHULQJ/HDG 352-(&7/2&$7,210$3176352-(&7$''5(66352-(&71$0('$7(352-(&7180%(56+((77,7/(&23<5,*+7127,&(7KLVGUDZLQJLVWKHSURSHUW\RIWKHDERYHUHIHUHQFHG3URIHVVLRQDODQGLVQRWWREHXVHGIRUDQ\SXUSRVHRWKHUWKDQWKHVSHFLILFSURMHFWDQGVLWHQDPHGKHUHLQDQGFDQQRWEHUHSURGXFHGLQDQ\PDQQHUZLWKRXWWKHH[SUHVVZULWWHQSHUPLVVLRQIURPWKH3URIHVVLRQDO&/,(17ZZZJUHHQEHUJIDUURZFRP6RXWK(YHUJUHHQ$YHQXH6XLWH$UOLQJWRQ+HLJKWV,/W 0feet3001" = 100'100300 This page is only a part of a 2016 ALTA Commitment for Title Insurance issued by Chicago Title Insurance Company. This Commitment is not valid without the Notice; the Commitment to Issue Policy; the Commitment Conditions; Schedule A; Schedule B, Part I-Requirements; Schedule B, Part II-Exceptions; and a counter-signature by the Company or its issuing agent that may be in electronic form. &RS\ULJKW$PHULFDQ/DQG7LWOH$VVRFLDWLRQ$OOULJKWVUHVHUYHG 7KHXVHRIWKLV)RUP RUDQ\GHULYDWLYHWKHUHRI LVUHVWULFWHGWR$/7$OLFHQVHHVDQG$/7$PHPEHUVLQJRRGVWDQGLQJDV RIWKHGDWHRIXVH$OORWKHUXVHVDUHSURKLELWHG5HSULQWHGXQGHUOLFHQVHIURPWKH$PHULFDQ/DQG7LWOH$VVRFLDWLRQ $/7$&RPPLWPHQWIRU7LWOH,QVXUDQFH 3ULQWHG # $0 3DJH ,/&7)68%636'. $/7$&200,70(17)257,7/(,1685$1&( &RPPLWPHQW1XPEHU ,VVXHG%\ '. 127,&( ,03257$17 5($' &$5()8//< 7+,6&200,70(17,6$12))(572,668(21(25025(7,7/( ,1685$1&( 32/,&,(6 $// &/$,06 25 5(0(',(6 628*+7 $*$,167 7+(&203$1< ,192/9,1* 7+( &217(172)7+,6&200,70(17257+(32/,&<0867%(%$6('62/(/<,1&2175$&7 7+,6&200,70(17,6127$1$%675$&72)7,7/(5(32572)7+(&21',7,212)7,7/(/(*$/23,1,21 23,1,212)7,7/(2527+(55(35(6(17$7,212)7+(67$7862)7,7/(7+(352&('85(686('%< 7+(&203$1<72'(7(50,1(,1685$%,/,7<2)7+(7,7/(,1&/8',1*$1<6($5&+$1'(;$0,1$7,21 $5(35235,(7$5<727+(&203$1<:(5(3(5)250('62/(/<)257+(%(1(),72)7+(&203$1< $1'&5($7(12(;75$&2175$&78$//,$%,/,7<72$1<3(5621,1&/8',1*$352326(',1685(' 7+(&203$1<¶62%/,*$7,2181'(57+,6&200,70(17,672,668($32/,&<72$352326(',1685(' ,'(17,),(',16&+('8/($,1$&&25'$1&(:,7+7+(7(506$1'3529,6,2162)7+,6&200,70(17 7+(&203$1<+$612/,$%,/,7<252%/,*$7,21,192/9,1*7+(&217(172)7+,6&200,70(1772$1< 27+(53(5621 &200,70(1772,668(32/,&< 6XEMHFWWRWKH1RWLFH 6FKHGXOH%3DUW,5HTXLUHPHQWV 6FKHGXOH%3DUW,,([FHSWLRQV DQGWKH&RPPLWPHQW&RQGLWLRQV &KLFDJR7LWOH,QVXUDQFH&RPSDQ\D )ORULGDFRUSRUDWLRQ WKH&RPSDQ\ FRPPLWVWRLVVXHWKH3ROLF\DFFRUGLQJWRWKH WHUPVDQGSURYLVLRQVRIWKLV&RPPLWPHQW7KLV&RPPLWPHQWLVHIIHFWLYHDVRIWKH&RPPLWPHQW'DWHVKRZQLQ6FKHGXOH$ IRUHDFK3ROLF\GHVFULEHGLQ6FKHGXOH$RQO\ZKHQWKH&RPSDQ\KDVHQWHUHGLQ6FKHGXOH$ERWKWKHVSHFLILHGGROODU DPRXQWDVWKH3URSRVHG3ROLF\$PRXQWDQGWKHQDPHRIWKH3URSRVHG,QVXUHG ,I DOO RI WKH 6FKHGXOH% 3DUW,5HTXLUHPHQWV KDYH QRW EHHQ PHW ZLWKLQ RQH KXQGUHG HLJKW\ GD\V DIWHU WKH &RPPLWPHQW'DWHWKLV&RPPLWPHQWWHUPLQDWHVDQGWKH&RPSDQ\¶VOLDELOLW\DQGREOLJDWLRQHQG &KLFDJR7LWOH,QVXUDQFH&RPSDQ\ %\ 5DQG\4XLUN3UHVLGHQW $WWHVW 0DUMRULH1HP]XUD6HFUHWDU\ This page is only a part of a 2016 ALTA Commitment for Title Insurance issued by Chicago Title Insurance Company. This Commitment is not valid without the Notice; the Commitment to Issue Policy; the Commitment Conditions; Schedule A; Schedule B, Part I-Requirements; Schedule B, Part II-Exceptions; and a counter-signature by the Company or its issuing agent that may be in electronic form. &RS\ULJKW$PHULFDQ/DQG7LWOH$VVRFLDWLRQ$OOULJKWVUHVHUYHG 7KHXVHRIWKLV)RUP RUDQ\GHULYDWLYHWKHUHRI LVUHVWULFWHGWR$/7$OLFHQVHHVDQG$/7$PHPEHUVLQJRRGVWDQGLQJDV RIWKHGDWHRIXVH$OORWKHUXVHVDUHSURKLELWHG5HSULQWHGXQGHUOLFHQVHIURPWKH$PHULFDQ/DQG7LWOH$VVRFLDWLRQ $/7$&RPPLWPHQWIRU7LWOH,QVXUDQFH 3ULQWHG # $0 3DJH ,/&7)68%636'. &+,&$*27,7/(,1685$1&(&203$1<&200,70(1712 '. 7UDQVDFWLRQ,GHQWLILFDWLRQ'DWDIRUUHIHUHQFHRQO\ 25,*,1$7,1*2)),&( )256(77/(0(17,148,5,(6&217$&7 &KLFDJR7LWOH&RPSDQ\ 0LGODQGV&RXUW6XLWH 6\FDPRUH,/ 0DLQ3KRQH (PDLO FWV\FDPRUH#FWWFRP ,VVXHG%\ &KLFDJR7LWOH&RPSDQ\ 0LGODQGV&RXUW6XLWH 6\FDPRUH,/ 2UGHU1XPEHU '. 3URSHUW\5HI %HHFKHU5RDG 6&+('8/($ &RPPLWPHQW'DWH 'HFHPEHU 3ROLF\WREHLVVXHG D $/7$2ZQHU V3ROLF\ 3URSRVHG,QVXUHG %RUUHJR6RODU6\VWHPV,QF 3URSRVHG3ROLF\$PRXQW 7KHHVWDWHRULQWHUHVWLQWKH/DQGGHVFULEHGRUUHIHUUHGWRLQWKLV&RPPLWPHQWLV )HH6LPSOH 7KH7LWOHLVDWWKH&RPPLWPHQW'DWHYHVWHGLQ 5REHUW0 ,OGHIRQVD/RIWXV/LYLQJ7UXVW &+,&$*27,7/(,1685$1&(&203$1<&200,70(1712 '. 6&+('8/($ FRQWLQXHG This page is only a part of a 2016 ALTA Commitment for Title Insurance issued by Chicago Title Insurance Company. This Commitment is not valid without the Notice; the Commitment to Issue Policy; the Commitment Conditions; Schedule A; Schedule B, Part I-Requirements; Schedule B, Part II-Exceptions; and a counter-signature by the Company or its issuing agent that may be in electronic form. &RS\ULJKW$PHULFDQ/DQG7LWOH$VVRFLDWLRQ$OOULJKWVUHVHUYHG 7KHXVHRIWKLV)RUP RUDQ\GHULYDWLYHWKHUHRI LVUHVWULFWHGWR$/7$OLFHQVHHVDQG$/7$PHPEHUVLQJRRGVWDQGLQJDV RIWKHGDWHRIXVH$OORWKHUXVHVDUHSURKLELWHG5HSULQWHGXQGHUOLFHQVHIURPWKH$PHULFDQ/DQG7LWOH$VVRFLDWLRQ $/7$&RPPLWPHQWIRU7LWOH,QVXUDQFH 3ULQWHG # $0 3DJH ,/&7)68%636'. 7KH/DQGLVGHVFULEHGDVIROORZV 7+$73$572)7+(6287+:(672)6(&7,21 3$572)7+(6287+($672)6(&7,21 $1'3$572)7+(1257+($672)6(&7,21 72:16+,31257+5$1*(($672)7+( 7+,5' 35,1&,3$/ 0(5,',$1 '(6&5,%(' $6 )2//2:6 &200(1&,1* 21 7+( 1257+ /,1( 2) 6(&7,21 $)25(6$,' &+$,16 :(67 2) 7+( 1257+($67 &251(5 7+(5(2) 7+(1&( 1257+'(*5((60,187(66(&21'6($67&+$,16727+(6287+5,*+72):$<2) 7+( &+,&$*2 %85/,1*721 $1' 48,1&< 5$,/52$' &203$1< )25 7+( 32,17 2) %(*,11,1* 7+(1&(6287+'(*5((60,187(66(&21'6:(67727+(&(17(5/,1(2)7+(%5,672/ $1'3/$1252$' 7+(1&(6287+($67(5/<$/21*6$,'&(17(5/,1(727+(&(17(52)52% 52<&5((. 7+(1&(1257+($67(5/<$/21*6$,'&(17(5/,1(727+(($67/,1(2)6(&7,21 7+(1&(1257+$/21*6$,'($67/,1(&+$,16727+(6287+:(67&251(52)6(&7,21 7+(1&(($67$/21*7+(6287+/,1(2)6$,'6(&7,21&+$,16 7+(1&(1257+($67(5/<72 $ 32,17 21 7+( 1257+ /,1( 2) 7+( 6287+:(67 2) 7+( 6287+:(672)6(&7,21 :+,&+,6&+$,16($672)7+(1257+:(67&251(52)6$,'48$57(548$57(5 7+(1&( :(67$/21*7+(1257+/,1(2)7+(6287+:(672)7+(6287+:(672)6(&7,21$1' $/21*7+(1257+/,1(2)7+(6287+($672)7+(6287+($672)6(&7,21727+( 1257+:(67&251(52)6$,'6287+($672)7+(6287+($67 7+(1&(6287+$/21*7+( :(67 /,1( 2) 6$,' 48$57(5 48$57(5 72 7+( 6287+ 5,*+72):$< /,1( 2) 7+( &+,&$*2 %85/,1*721 $1' 48,1&< 5$,/52$' &203$1< 7+(1&( :(67(5/< $/21*6$,' 6287+ 5,*+72):$<727+(32,172)%(*,11,1* (;&(37,1*7+(5()5207+(5,*+72):$<2)7+( &+,&$*2%85/,1*721$1'48,1&<5$,/52$'&203$1< ,17+(72:16+,32)%5,672/.(1'$// &2817<,//,12,6 (1'2)6&+('8/($ This page is only a part of a 2016 ALTA Commitment for Title Insurance issued by Chicago Title Insurance Company. This Commitment is not valid without the Notice; the Commitment to Issue Policy; the Commitment Conditions; Schedule A; Schedule B, Part I-Requirements; Schedule B, Part II-Exceptions; and a counter-signature by the Company or its issuing agent that may be in electronic form. &RS\ULJKW$PHULFDQ/DQG7LWOH$VVRFLDWLRQ$OOULJKWVUHVHUYHG 7KHXVHRIWKLV)RUP RUDQ\GHULYDWLYHWKHUHRI LVUHVWULFWHGWR$/7$OLFHQVHHVDQG$/7$PHPEHUVLQJRRGVWDQGLQJDV RIWKHGDWHRIXVH$OORWKHUXVHVDUHSURKLELWHG5HSULQWHGXQGHUOLFHQVHIURPWKH$PHULFDQ/DQG7LWOH$VVRFLDWLRQ $/7$&RPPLWPHQWIRU7LWOH,QVXUDQFH 3ULQWHG # $0 3DJH ,/&7)68%636'. &+,&$*27,7/(,1685$1&(&203$1<&200,70(1712 '. 6&+('8/(%3$57, 5(48,5(0(176 $OORIWKHIROORZLQJ5HTXLUHPHQWVPXVWEHPHW 7KH 3URSRVHG ,QVXUHG PXVW QRWLI\ WKH &RPSDQ\ LQ ZULWLQJ RI WKH QDPH RI DQ\ SDUW\ QRW UHIHUUHG WR LQ WKLV &RPPLWPHQWZKRZLOOREWDLQDQLQWHUHVWLQWKH/DQGRUZKRZLOOPDNHDORDQRQWKH/DQG7KH&RPSDQ\PD\WKHQ PDNHDGGLWLRQDO5HTXLUHPHQWVRU([FHSWLRQV 3D\WKHDJUHHGDPRXQWIRUWKHHVWDWHRULQWHUHVWWREHLQVXUHG 3D\WKHSUHPLXPVIHHVDQGFKDUJHVIRUWKH3ROLF\WRWKH&RPSDQ\ 'RFXPHQWVVDWLVIDFWRU\WRWKH&RPSDQ\WKDWFRQYH\WKH7LWOHRUFUHDWHWKH0RUWJDJHWREHLQVXUHGRUERWKPXVW EHSURSHUO\DXWKRUL]HGH[HFXWHGGHOLYHUHGDQGUHFRUGHGLQWKH3XEOLF5HFRUGV 1RWLFH 3OHDVHEHDZDUHWKDWGXHWRWKHFRQIOLFWEHWZHHQIHGHUDODQGVWDWHODZVFRQFHUQLQJWKHFXOWLYDWLRQ GLVWULEXWLRQPDQXIDFWXUHRUVDOHRIPDULMXDQDWKH&RPSDQ\LVQRWDEOHWRFORVHRULQVXUHDQ\WUDQVDFWLRQLQYROYLQJ /DQGWKDWLVDVVRFLDWHGZLWKWKHVHDFWLYLWLHV 7KH3URSRVHG3ROLF\$PRXQW V PXVWEHLQFUHDVHGWRWKHIXOOYDOXHRIWKHHVWDWHRULQWHUHVWEHLQJLQVXUHG DQGDQ\DGGLWLRQDOSUHPLXPPXVWEHSDLGDWWKDWWLPH$Q2ZQHU V3ROLF\VKRXOGUHIOHFWWKHSXUFKDVH SULFHRUIXOOYDOXHRIWKH/DQG$/RDQ3ROLF\VKRXOGUHIOHFWWKHORDQDPRXQWRUYDOXHRIWKHSURSHUW\DV FROODWHUDO3URSRVHG3ROLF\$PRXQW V ZLOOEHUHYLVHGDQGSUHPLXPVFKDUJHGFRQVLVWHQWWKHUHZLWKZKHQ WKHILQDODPRXQWVDUHDSSURYHG %HDGYLVHGWKDWWKHJRRGIXQGVRIWKHWLWOHLQVXUDQFHDFW ,/&6 EHFDPHHIIHFWLYH7KLVDFW SODFHVOLPLWDWLRQVXSRQWKHVHWWOHPHQWDJHQW VDELOLW\WRDFFHSWFHUWDLQW\SHVRIGHSRVLWVLQWRHVFURZ3OHDVH FRQWDFW\RXUORFDO&KLFDJR7LWOHRIILFHUHJDUGLQJWKHDSSOLFDWLRQRIWKLVQHZODZWR\RXUWUDQVDFWLRQ (IIHFWLYH-XQH SXUVXDQWWR3XEOLF$FW VDWLVIDFWRU\HYLGHQFHRILGHQWLILFDWLRQPXVWEHSUHVHQWHGIRU WKHQRWDUL]DWLRQRIDQ\DQGDOOGRFXPHQWVQRWDUL]HGE\DQ,OOLQRLVQRWDU\SXEOLF6DWLVIDFWRU\LGHQWLILFDWLRQ GRFXPHQWVDUHGRFXPHQWVWKDWDUHYDOLGDWWKHWLPHRIWKHQRWDULDODFW DUHLVVXHGE\DVWDWHRUIHGHUDOJRYHUQPHQW DJHQF\ EHDUWKHSKRWRJUDSKLFLPDJHRIWKHLQGLYLGXDO¶VIDFH DQGEHDUWKHLQGLYLGXDO¶VVLJQDWXUH 7KH&RPSDQ\VKRXOGEHIXUQLVKHGDVWDWHPHQWWKDWWKHUHLVQRSURSHUW\PDQDJHUHPSOR\HGWRPDQDJHWKH/DQG RULQWKHDOWHUQDWLYHDILQDOOLHQZDLYHUIURPDQ\VXFKSURSHUW\PDQDJHU 7KH&RPSDQ\VKRXOGEHSURYLGHGDVWDWHPHQWIURPWKHERUURZHU V UHODWLYHWRDQ\PRUWJDJHLGHQWLILHGLQ6FKHGXOH %GLVFORVLQJZKHWKHUWKHERUURZHU V KDYHHQWHUHGLQWRDQ\IRUEHDUDQFHRUORDQPRGLILFDWLRQDJUHHPHQWZLWKWKH OHQGHUUHODWLYHWRGHOD\HGRUSRVWSRQHGSD\PHQWVRURWKHUUHVWUXFWXULQJRIWKHGHEWVHFXUHGE\WKHPRUWJDJH (1'2)6&+('8/(%3$57, This page is only a part of a 2016 ALTA Commitment for Title Insurance issued by Chicago Title Insurance Company. This Commitment is not valid without the Notice; the Commitment to Issue Policy; the Commitment Conditions; Schedule A; Schedule B, Part I-Requirements; Schedule B, Part II-Exceptions; and a counter-signature by the Company or its issuing agent that may be in electronic form. &RS\ULJKW$PHULFDQ/DQG7LWOH$VVRFLDWLRQ$OOULJKWVUHVHUYHG 7KHXVHRIWKLV)RUP RUDQ\GHULYDWLYHWKHUHRI LVUHVWULFWHGWR$/7$OLFHQVHHVDQG$/7$PHPEHUVLQJRRGVWDQGLQJDV RIWKHGDWHRIXVH$OORWKHUXVHVDUHSURKLELWHG5HSULQWHGXQGHUOLFHQVHIURPWKH$PHULFDQ/DQG7LWOH$VVRFLDWLRQ $/7$&RPPLWPHQWIRU7LWOH,QVXUDQFH 3ULQWHG # $0 3DJH ,/&7)68%636'. &+,&$*27,7/(,1685$1&(&203$1<&200,70(1712 '. 6&+('8/(%3$57,, (;&(37,216 7+,6 &200,70(17 '2(6 127 5(38%/,6+ $1< &29(1$17 &21',7,21 5(675,&7,21 25 /,0,7$7,21 &217$,1(',1$1<'2&80(175()(55('72,17+,6&200,70(17727+((;7(177+$77+(63(&,),& &29(1$17&21',7,215(675,&7,2125/,0,7$7,219,2/$7(667$7(25)('(5$//$:%$6('215$&( &2/25 5(/,*,21 6(; 6(;8$/ 25,(17$7,21 *(1'(5 ,'(17,7< +$1',&$3 )$0,/,$/ 67$786 25 1$7,21$/25,*,1 7KH3ROLF\ZLOOQRWLQVXUHDJDLQVWORVVRUGDPDJHUHVXOWLQJIURPWKHWHUPVDQGSURYLVLRQVRIDQ\OHDVHRUHDVHPHQW LGHQWLILHGLQ6FKHGXOH$DQGZLOOLQFOXGHWKHIROORZLQJ([FHSWLRQVXQOHVVFOHDUHGWRWKHVDWLVIDFWLRQRIWKH&RPSDQ\ *HQHUDO([FHSWLRQV > 5LJKWVRUFODLPVRISDUWLHVLQSRVVHVVLRQQRWVKRZQE\3XEOLF5HFRUGV > $Q\HQFURDFKPHQWHQFXPEUDQFHYLRODWLRQYDULDWLRQRUDGYHUVHFLUFXPVWDQFHDIIHFWLQJWKHWLWOH WKDWZRXOGEHGLVFORVHGE\DQDFFXUDWHDQGFRPSOHWHODQGVXUYH\RIWKH/DQG > (DVHPHQWVRUFODLPVRIHDVHPHQWVQRWVKRZQE\WKH3XEOLF5HFRUGV > $Q\OLHQRUULJKWWRDOLHQIRUVHUYLFHVODERURUPDWHULDOKHUHWRIRUHRUKHUHDIWHUIXUQLVKHG LPSRVHGE\ODZDQGQRWVKRZQE\WKH3XEOLF5HFRUGV > 7D[HVRUVSHFLDODVVHVVPHQWVZKLFKDUHQRWVKRZQDVH[LVWLQJOLHQVE\WKH3XEOLF5HFRUGV > :HVKRXOGEHIXUQLVKHGDSURSHUO\H[HFXWHG$/7$VWDWHPHQWDQGXQOHVVWKHODQGLQVXUHGLVD FRQGRPLQLXPXQLWDVXUYH\LIDYDLODEOH0DWWHUVGLVFORVHGE\WKHDERYHGRFXPHQWDWLRQZLOOEH VKRZQVSHFLILFDOO\ > $Q\GHIHFWOLHQHQFXPEUDQFHDGYHUVHFODLPRURWKHUPDWWHUWKDWDSSHDUVIRUWKHILUVWWLPHLQWKH3XEOLF 5HFRUGVRULVFUHDWHGDWWDFKHVRULVGLVFORVHGEHWZHHQWKH&RPPLWPHQW'DWHDQGWKHGDWHRQZKLFKDOO RIWKH6FKHGXOH%3DUW,5HTXLUHPHQWVDUHPHW > $ 7D[HVIRUWKH\HDUVDQG 7D[HVIRUWKH\HDUVDQGDUHQRW\HWGXHRUSD\DEOH 3HUPDQHQW7D[1R 1RWH 7D[HVIRUWKH\HDUDPRXQWLQJWRDUHSDLGRIUHFRUG > % 7D[HVIRUWKH\HDUVDQG 7D[HVIRUWKH\HDUVDQGDUHQRW\HWGXHRUSD\DEOH 3HUPDQHQW7D[1R &+,&$*27,7/(,1685$1&(&203$1<&200,70(1712 '. 6&+('8/(%3$57,, (;&(37,216 FRQWLQXHG This page is only a part of a 2016 ALTA Commitment for Title Insurance issued by Chicago Title Insurance Company. This Commitment is not valid without the Notice; the Commitment to Issue Policy; the Commitment Conditions; Schedule A; Schedule B, Part I-Requirements; Schedule B, Part II-Exceptions; and a counter-signature by the Company or its issuing agent that may be in electronic form. &RS\ULJKW$PHULFDQ/DQG7LWOH$VVRFLDWLRQ$OOULJKWVUHVHUYHG 7KHXVHRIWKLV)RUP RUDQ\GHULYDWLYHWKHUHRI LVUHVWULFWHGWR$/7$OLFHQVHHVDQG$/7$PHPEHUVLQJRRGVWDQGLQJDV RIWKHGDWHRIXVH$OORWKHUXVHVDUHSURKLELWHG5HSULQWHGXQGHUOLFHQVHIURPWKH$PHULFDQ/DQG7LWOH$VVRFLDWLRQ $/7$&RPPLWPHQWIRU7LWOH,QVXUDQFH 3ULQWHG # $0 3DJH ,/&7)68%636'. 1RWH 7D[HVIRUWKH\HDUDPRXQWLQJWRDUHSDLGRIUHFRUG > & 7D[HVIRUWKH\HDUVDQG 7D[HVIRUWKH\HDUVDQGDUHQRW\HWGXHRUSD\DEOH 3HUPDQHQW7D[1R 1RWH 7D[HVIRUWKH\HDUDPRXQWLQJWR DUHSDLGRIUHFRUG > 0 7KHVHDUFKGLGQRWGLVFORVHDQ\RSHQPRUWJDJHVRUGHHGVRIWUXVWRIUHFRUGWKHUHIRUHWKH&RPSDQ\ UHVHUYHVWKHULJKWWRUHTXLUHIXUWKHUHYLGHQFHWRFRQILUPWKDWWKHSURSHUW\LVXQHQFXPEHUHGDQGIXUWKHU UHVHUYHVWKHULJKWWRPDNHDGGLWLRQDOUHTXLUHPHQWVRUDGGDGGLWLRQDOLWHPVRUH[FHSWLRQVXSRQUHFHLSWRI WKHUHTXHVWHGHYLGHQFH > 6 $Q\ULJKWLQWHUHVWRUFODLPWKDWPD\H[LVWDULVHRUEHDVVHUWHGDJDLQVWWKH7LWOHXQGHURUSXUVXDQWWRWKH 3HULVKDEOH$JULFXOWXUDO&RPPRGLWLHV$FWRI DVDPHQGHG86& DHWVHTWKH3DFNHUVDQG 6WRFN\DUG$FWRI DVDPHQGHG86&HWVHTRUDQ\VLPLODUVWDWHODZV > 2 7KH&RPSDQ\ZLOOUHTXLUHWKHIROORZLQJGRFXPHQWVIRUUHYLHZSULRUWRWKHLVVXDQFHRIDQ\WLWOHLQVXUDQFH SUHGLFDWHGXSRQDFRQYH\DQFHRUHQFXPEUDQFHE\WKHFRUSRUDWLRQQDPHGEHORZ 1DPHRI&RUSRUDWLRQ %RUUHJR6RODU6\VWHPV,QF D $&RS\RIWKHFRUSRUDWLRQ%\ODZVDQG$UWLFOHVRI,QFRUSRUDWLRQ E $QRULJLQDORUFHUWLILHGFRS\RIDUHVROXWLRQDXWKRUL]LQJWKHWUDQVDFWLRQFRQWHPSODWHGKHUHLQ F ,IWKH$UWLFOHVDQGRU%\ODZVUHTXLUHDSSURYDOE\DµSDUHQW¶RUJDQL]DWLRQDFRS\RIWKH$UWLFOHVDQG %\ODZVRIWKHSDUHQW G $FXUUHQWGDWHGFHUWLILFDWHRIJRRGVWDQGLQJIURPWKHSURSHUJRYHUQPHQWDODXWKRULW\RIWKHVWDWHLQ ZKLFKWKHHQWLW\ZDVFUHDWHG 7KH&RPSDQ\UHVHUYHVWKHULJKWWRDGGDGGLWLRQDOLWHPVRUPDNHIXUWKHUUHTXLUHPHQWVDIWHUUHYLHZRIWKH UHTXHVWHGGRFXPHQWDWLRQ > ' 7KH/DQGGHVFULEHGLQ6FKHGXOH$HLWKHULVXQVXEGLYLGHGSURSHUW\RUFRQVWLWXWHVSDUWRIDVXEGLYLGHGORW $VDUHVXOWD3ODW$FW$IILGDYLWVKRXOGDFFRPSDQ\DQ\FRQYH\DQFHWREHUHFRUGHG,QWKHDOWHUQDWLYH FRPSOLDQFHVKRXOGEHKDGZLWKWKHSURYLVLRQVRIWKH3ODW$FW ,/&6HWVHT > 5 7KHGHHGVIURP5REHUWDQG,OGHIRQVD/RIWXVWRWKH5REHU0 ,OGHIRQVD/RIWXV/LYLQJ7UXVWUHFRUGHGDV GRFXPHQWVDQG PD\EHGHIHFWLYHLQWKDWWKHSURSHUIRUPRIGHHGZDVQRWXVHG DQGDOVRWKHOHJDOGHVFULSWLRQVRQVDLGGHHGVDUHLQFRPSOHWH &+,&$*27,7/(,1685$1&(&203$1<&200,70(1712 '. 6&+('8/(%3$57,, (;&(37,216 FRQWLQXHG This page is only a part of a 2016 ALTA Commitment for Title Insurance issued by Chicago Title Insurance Company. This Commitment is not valid without the Notice; the Commitment to Issue Policy; the Commitment Conditions; Schedule A; Schedule B, Part I-Requirements; Schedule B, Part II-Exceptions; and a counter-signature by the Company or its issuing agent that may be in electronic form. &RS\ULJKW$PHULFDQ/DQG7LWOH$VVRFLDWLRQ$OOULJKWVUHVHUYHG 7KHXVHRIWKLV)RUP RUDQ\GHULYDWLYHWKHUHRI LVUHVWULFWHGWR$/7$OLFHQVHHVDQG$/7$PHPEHUVLQJRRGVWDQGLQJDV RIWKHGDWHRIXVH$OORWKHUXVHVDUHSURKLELWHG5HSULQWHGXQGHUOLFHQVHIURPWKH$PHULFDQ/DQG7LWOH$VVRFLDWLRQ $/7$&RPPLWPHQWIRU7LWOH,QVXUDQFH 3ULQWHG # $0 3DJH ,/&7)68%636'. > ( 7KH&RPSDQ\VKRXOGEHIXUQLVKHGWKHIROORZLQJ D$&HUWLILFDWLRQRI5REHUW0 ,OGHIRQVD/RIWXV/LYLQJ7UXVWH[HFXWHGE\WKHWUXVWHHLQDFFRUGDQFH ZLWK,/&6WRJHWKHUZLWKH[FHUSWVRIWKHWUXVWDJUHHPHQWDQGDPHQGPHQWVWKHUHWRUHODWLQJWR WKHGHVLJQDWLRQRIWUXVWHHVDQGWKHSRZHURIWKHWUXVWHHWRDFWLQWKHFXUUHQWWUDQVDFWLRQRU E,QWKHDOWHUQDWLYHWKHWUXVWHHLQKLVRUKHUVROHGLVFUHWLRQPD\GHOLYHUWRWKH&RPSDQ\DIXOOFRS\RI WKHWUXVWDJUHHPHQWWRJHWKHUZLWKDOODPHQGPHQWVWKHUHWR 7KH&RPSDQ\UHVHUYHVWKHULJKWWRDGGDGGLWLRQDOLWHPVRUPDNHIXUWKHUUHTXLUHPHQWVDIWHUUHYLHZRIWKH UHTXHVWHGGRFXPHQWDWLRQ > ) 7HUPVSRZHUVSURYLVLRQVDQGOLPLWDWLRQVRIWKH7UXVWXQGHUZKLFKWLWOHWRWKH/DQGLVKHOG > 1 ([LVWLQJXQUHFRUGHGOHDVHVDQGDOOULJKWVWKHUHXQGHURIWKHOHVVHHVDQGRIDQ\SHUVRQRUSDUW\FODLPLQJE\ WKURXJKRUXQGHUWKHOHVVHHV > . 5LJKWVRIWKHSXEOLFWKH6WDWHRI,OOLQRLVDQGWKHPXQLFLSDOLW\LQDQGWRWKDWSDUWRIWKH/DQGLIDQ\WDNHQRU XVHGIRU%HHFKHU5RDGDQG)D[RQ5RDGWRJHWKHUZLWKXWLOLW\ULJKWVWKHUHLQ > * 5LJKWVRIWKHSXEOLFWKH6WDWHRI,OOLQRLVDQGWKHPXQLFLSDOLW\LQDQGWRDQ\RWKHUSDUWRIWKH/DQGLIDQ\ WDNHQRUXVHGIRUURDGSXUSRVHVWRJHWKHUZLWKXWLOLW\ULJKWVWKHUHLQ > + 5LJKWVRI:D\IRUGUDLQDJHWLOHVGLWFKHVIHHGHUVODWHUDOVDQGXQGHUJURXQGSLSHVLIDQ\ > , 5LJKWVRI:D\IRUUDLOURDGVZLWFKDQGVSXUWUDFNVLIDQ\ > - 5LJKWVRIDGMRLQLQJDQGFRQWLJXRXVRZQHUVWRKDYHPDLQWDLQHGWKHXQLQWHUUXSWHGIORZRIWKHZDWHUVRIDQ\ VWUHDPZKLFKPD\IORZRQRUWKURXJKWKH/DQG > / 7HUPVSURYLVLRQVDQGFRQGLWLRQVFRQWDLQHGLQJUDQWUHFRUGHGLQGHHGUHFRUGHG)HEUXDU\ LQ GHHG UHFRUGSDJH RIWKHULJKWWROD\PDLQWDLQDOWHUUHSDLURSHUDWHDQGUHPRYHDGUDLQWLOHPDLQIRUWKH GUDLQDJHRIVXUIDFHZDWHUVDQGIRUWKHWUDQVSRUWDWLRQRIVXUIDFHZDWHUVDQGIRUWKHWUDQVSRUWDWLRQRI VXUIDFHZDWHUVZLWKWKHULJKWRILQJUHVVDQGHJUHVVWRDQGIURPVDLGULJKWRIZD\ > 3 $OOHQGRUVHPHQWUHTXHVWVVKRXOGEHPDGHSULRUWRFORVLQJWRDOORZDPSOHWLPHIRUWKHFRPSDQ\WRH[DPLQH UHTXLUHGGRFXPHQWDWLRQ 7KLVQRWHZLOOEHZDLYHGIRUSROLF\ &+,&$*27,7/(,1685$1&(&203$1<&200,70(1712 '. 6&+('8/(%3$57,, (;&(37,216 FRQWLQXHG This page is only a part of a 2016 ALTA Commitment for Title Insurance issued by Chicago Title Insurance Company. This Commitment is not valid without the Notice; the Commitment to Issue Policy; the Commitment Conditions; Schedule A; Schedule B, Part I-Requirements; Schedule B, Part II-Exceptions; and a counter-signature by the Company or its issuing agent that may be in electronic form. &RS\ULJKW$PHULFDQ/DQG7LWOH$VVRFLDWLRQ$OOULJKWVUHVHUYHG 7KHXVHRIWKLV)RUP RUDQ\GHULYDWLYHWKHUHRI LVUHVWULFWHGWR$/7$OLFHQVHHVDQG$/7$PHPEHUVLQJRRGVWDQGLQJDV RIWKHGDWHRIXVH$OORWKHUXVHVDUHSURKLELWHG5HSULQWHGXQGHUOLFHQVHIURPWKH$PHULFDQ/DQG7LWOH$VVRFLDWLRQ $/7$&RPPLWPHQWIRU7LWOH,QVXUDQFH 3ULQWHG # $0 3DJH ,/&7)68%636'. > 4 ,QIRUPDWLRQDOQRWH 7RVFKHGXOHFORVLQJVLQWKH6\FDPRUHRIILFHSOHDVHFDOO RU )RUFORVLQJLQIRUPDWLRQILJXUHVSOHDVHFDOOWKHVFKHGXOLQJRIILFH > (1'2)6&+('8/(%3$57,, &+,&$*27,7/(,1685$1&(&203$1<&200,70(1712 '. &200,70(17&21',7,216 This page is only a part of a 2016 ALTA Commitment for Title Insurance issued by Chicago Title Insurance Company. This Commitment is not valid without the Notice; the Commitment to Issue Policy; the Commitment Conditions; Schedule A; Schedule B, Part I-Requirements; Schedule B, Part II-Exceptions; and a counter-signature by the Company or its issuing agent that may be in electronic form. &RS\ULJKW$PHULFDQ/DQG7LWOH$VVRFLDWLRQ$OOULJKWVUHVHUYHG 7KHXVHRIWKLV)RUP RUDQ\GHULYDWLYHWKHUHRI LVUHVWULFWHGWR$/7$OLFHQVHHVDQG$/7$PHPEHUVLQJRRGVWDQGLQJDV RIWKHGDWHRIXVH$OORWKHUXVHVDUHSURKLELWHG5HSULQWHGXQGHUOLFHQVHIURPWKH$PHULFDQ/DQG7LWOH$VVRFLDWLRQ $/7$&RPPLWPHQWIRU7LWOH,QVXUDQFH 3ULQWHG # $0 3DJH ,/&7)68%636'. '(),1,7,216 D .QRZOHGJHRU.QRZQ $FWXDORULPSXWHGNQRZOHGJHEXWQRWFRQVWUXFWLYHQRWLFHLPSDUWHGE\WKH3XEOLF5HFRUGV E /DQG 7KHODQGGHVFULEHGLQ6FKHGXOH$DQGDIIL[HGLPSURYHPHQWVWKDWE\ODZFRQVWLWXWHUHDOSURSHUW\7KHWHUP/DQGGRHVQRWLQFOXGH DQ\SURSHUW\EH\RQGWKHOLQHVRIWKHDUHDGHVFULEHGLQ6FKHGXOH$QRUDQ\ULJKWWLWOHLQWHUHVWHVWDWHRUHDVHPHQWLQDEXWWLQJVWUHHWVURDGV DYHQXHVDOOH\VODQHVZD\VRUZDWHUZD\VEXWWKLVGRHVQRWPRGLI\RUOLPLWWKHH[WHQWWKDWDULJKWRIDFFHVVWRDQGIURPWKH/DQGLVWREH LQVXUHGE\WKH3ROLF\ F 0RUWJDJH $PRUWJDJHGHHGRIWUXVWRURWKHUVHFXULW\LQVWUXPHQWLQFOXGLQJRQHHYLGHQFHGE\HOHFWURQLFPHDQVDXWKRUL]HGE\ODZ G 3ROLF\ (DFKFRQWUDFWRIWLWOHLQVXUDQFHLQDIRUPDGRSWHGE\WKH$PHULFDQ/DQG7LWOH$VVRFLDWLRQLVVXHGRUWREHLVVXHGE\WKH&RPSDQ\ SXUVXDQWWRWKLV&RPPLWPHQW H 3URSRVHG,QVXUHG (DFKSHUVRQLGHQWLILHGLQ6FKHGXOH$DVWKH3URSRVHG,QVXUHGRIHDFK3ROLF\WREHLVVXHGSXUVXDQWWRWKLV&RPPLWPHQW I 3URSRVHG3ROLF\$PRXQW (DFKGROODUDPRXQWVSHFLILHGLQ6FKHGXOH$DVWKH3URSRVHG3ROLF\$PRXQWRIHDFK3ROLF\WREHLVVXHGSXUVXDQW WRWKLV&RPPLWPHQW J 3XEOLF5HFRUGV 5HFRUGVHVWDEOLVKHGXQGHUVWDWHVWDWXWHVDWWKH&RPPLWPHQW'DWHIRUWKHSXUSRVHRILPSDUWLQJFRQVWUXFWLYHQRWLFHRI PDWWHUVUHODWLQJWRUHDOSURSHUW\WRSXUFKDVHUVIRUYDOXHDQGZLWKRXW.QRZOHGJH K 7LWOH 7KHHVWDWHRULQWHUHVWGHVFULEHGLQ6FKHGXOH$ ,I DOO RI WKH 6FKHGXOH% 3DUW,5HTXLUHPHQWV KDYH QRW EHHQ PHWZLWKLQWKHWLPHSHULRGVSHFLILHGLQWKH&RPPLWPHQWWR,VVXH3ROLF\ WKLV &RPPLWPHQWWHUPLQDWHVDQGWKH&RPSDQ\ VOLDELOLW\DQGREOLJDWLRQHQG 7KH&RPSDQ\ VOLDELOLW\DQGREOLJDWLRQLVOLPLWHGE\DQGWKLV&RPPLWPHQWLVQRWYDOLGZLWKRXW D WKH1RWLFH E WKH&RPPLWPHQWWR,VVXH3ROLF\ F WKH&RPPLWPHQW&RQGLWLRQV G 6FKHGXOH$ H 6FKHGXOH%3DUW,5HTXLUHPHQWV I 6FKHGXOH%3DUW,,([FHSWLRQV DQG J DFRXQWHUVLJQDWXUHE\WKH&RPSDQ\RULWVLVVXLQJDJHQWWKDWPD\EHLQHOHFWURQLFIRUP &203$1< 65,*+772$0(1' 7KH&RPSDQ\PD\DPHQGWKLV&RPPLWPHQWDWDQ\WLPH,IWKH&RPSDQ\DPHQGVWKLV&RPPLWPHQWWRDGGDGHIHFWOLHQHQFXPEUDQFHDGYHUVH FODLPRURWKHUPDWWHUUHFRUGHGLQWKH3XEOLF5HFRUGVSULRUWRWKH&RPPLWPHQW'DWHDQ\OLDELOLW\RIWKH&RPSDQ\LVOLPLWHGE\&RPPLWPHQW &RQGLWLRQ7KH&RPSDQ\VKDOOQRWEHOLDEOHIRUDQ\RWKHUDPHQGPHQWWRWKLV&RPPLWPHQW /,0,7$7,2162)/,$%,/,7< D 7KH&RPSDQ\ VOLDELOLW\XQGHU&RPPLWPHQW&RQGLWLRQLVOLPLWHGWRWKH3URSRVHG,QVXUHG VDFWXDOH[SHQVHLQFXUUHGLQWKHLQWHUYDOEHWZHHQ WKH&RPSDQ\ VGHOLYHU\WRWKH3URSRVHG,QVXUHGRIWKH&RPPLWPHQW DQGWKHGHOLYHU\RIWKHDPHQGHG&RPPLWPHQWUHVXOWLQJIURP WKH 3URSRVHG,QVXUHG VJRRGIDLWKUHOLDQFHWR L FRPSO\ZLWKWKH6FKHGXOH%3DUW,5HTXLUHPHQWV LL HOLPLQDWHZLWKWKH&RPSDQ\ VZULWWHQFRQVHQWDQ\6FKHGXOH%3DUW,,([FHSWLRQV RU LLL DFTXLUHWKH7LWOHRUFUHDWHWKH0RUWJDJHFRYHUHGE\WKLV&RPPLWPHQW E 7KH&RPSDQ\VKDOOQRWEHOLDEOHXQGHU&RPPLWPHQW&RQGLWLRQ D LIWKH3URSRVHG,QVXUHGUHTXHVWHGWKHDPHQGPHQWRUKDG.QRZOHGJHRI WKHPDWWHUDQGGLGQRWQRWLI\WKH&RPSDQ\DERXWLWLQZULWLQJ F 7KH&RPSDQ\ZLOORQO\KDYHOLDELOLW\XQGHU&RPPLWPHQW&RQGLWLRQLIWKH3URSRVHG,QVXUHGZRXOGQRWKDYHLQFXUUHGWKHH[SHQVHKDGWKH &RPPLWPHQWLQFOXGHGWKHDGGHGPDWWHUZKHQWKH&RPPLWPHQWZDVILUVWGHOLYHUHGWRWKH3URSRVHG,QVXUHG G 7KH &RPSDQ\ V OLDELOLW\ VKDOO QRW H[FHHG WKH OHVVHU RI WKH3URSRVHG ,QVXUHG V DFWXDO H[SHQVH LQFXUUHG LQ JRRG IDLWK DQG GHVFULEHG LQ &RPPLWPHQW&RQGLWLRQV D L WKURXJK D LLL RUWKH3URSRVHG3ROLF\$PRXQW H 7KH&RPSDQ\VKDOOQRWEHOLDEOHIRUWKHFRQWHQWRIWKH7UDQVDFWLRQ,GHQWLILFDWLRQ'DWDLIDQ\ I ,Q QR HYHQW VKDOO WKH &RPSDQ\ EH REOLJDWHG WR LVVXH WKH 3ROLF\ UHIHUUHG WR LQ WKLV &RPPLWPHQW XQOHVV DOO RI WKH 6FKHGXOH% 3DUW,5HTXLUHPHQWVKDYHEHHQPHWWRWKHVDWLVIDFWLRQRIWKH&RPSDQ\ J ,QDQ\HYHQWWKH&RPSDQ\ VOLDELOLW\LVOLPLWHGE\WKHWHUPVDQGSURYLVLRQVRIWKH3ROLF\ /,$%,/,7<2)7+(&203$1<0867%(%$6('217+,6&200,70(17 D 2QO\D3URSRVHG,QVXUHGLGHQWLILHGLQ6FKHGXOH$DQGQRRWKHUSHUVRQPD\PDNHDFODLPXQGHUWKLV&RPPLWPHQW E $Q\FODLPPXVWEHEDVHGLQFRQWUDFWDQGPXVWEHUHVWULFWHGVROHO\WRWKHWHUPVDQGSURYLVLRQVRIWKLV&RPPLWPHQW &+,&$*27,7/(,1685$1&(&203$1<&200,70(1712 '. FRQWLQXHG This page is only a part of a 2016 ALTA Commitment for Title Insurance issued by Chicago Title Insurance Company. This Commitment is not valid without the Notice; the Commitment to Issue Policy; the Commitment Conditions; Schedule A; Schedule B, Part I-Requirements; Schedule B, Part II-Exceptions; and a counter-signature by the Company or its issuing agent that may be in electronic form. &RS\ULJKW$PHULFDQ/DQG7LWOH$VVRFLDWLRQ$OOULJKWVUHVHUYHG 7KHXVHRIWKLV)RUP RUDQ\GHULYDWLYHWKHUHRI LVUHVWULFWHGWR$/7$OLFHQVHHVDQG$/7$PHPEHUVLQJRRGVWDQGLQJDV RIWKHGDWHRIXVH$OORWKHUXVHVDUHSURKLELWHG5HSULQWHGXQGHUOLFHQVHIURPWKH$PHULFDQ/DQG7LWOH$VVRFLDWLRQ $/7$&RPPLWPHQWIRU7LWOH,QVXUDQFH 3ULQWHG # $0 3DJH ,/&7)68%636'. F 8QWLOWKH3ROLF\LVLVVXHGWKLV&RPPLWPHQWDVODVWUHYLVHGLVWKHH[FOXVLYHDQGHQWLUHDJUHHPHQWEHWZHHQWKHSDUWLHVZLWKUHVSHFWWRWKH VXEMHFWPDWWHURIWKLV&RPPLWPHQWDQGVXSHUVHGHVDOOSULRUFRPPLWPHQWQHJRWLDWLRQVUHSUHVHQWDWLRQVDQGSURSRVDOVRIDQ\NLQGZKHWKHU ZULWWHQRURUDOH[SUHVVRULPSOLHGUHODWLQJWRWKHVXEMHFWPDWWHURIWKLV&RPPLWPHQW G 7KHGHOHWLRQRUPRGLILFDWLRQRIDQ\6FKHGXOH%3DUW,,([FHSWLRQGRHVQRWFRQVWLWXWHDQDJUHHPHQWRUREOLJDWLRQWRSURYLGHFRYHUDJHEH\RQG WKHWHUPVDQGSURYLVLRQVRIWKLV&RPPLWPHQWRUWKH3ROLF\ H $Q\DPHQGPHQWRUHQGRUVHPHQWWRWKLV&RPPLWPHQWPXVWEHLQZULWLQJDQGDXWKHQWLFDWHGE\DSHUVRQDXWKRUL]HGE\WKH&RPSDQ\ I :KHQWKH3ROLF\LVLVVXHGDOOOLDELOLW\DQGREOLJDWLRQXQGHUWKLV&RPPLWPHQWZLOOHQGDQGWKH&RPSDQ\ VRQO\OLDELOLW\ZLOOEHXQGHUWKH3ROLF\ ,)7+,6&200,70(17+$6%((1,668('%<$1,668,1*$*(17 7KHLVVXLQJDJHQWLVWKH&RPSDQ\ VDJHQWRQO\IRUWKHOLPLWHGSXUSRVHRILVVXLQJWLWOHLQVXUDQFHFRPPLWPHQWVDQGSROLFLHV7KHLVVXLQJDJHQWLV QRWWKH&RPSDQ\ VDJHQWIRUWKHSXUSRVHRISURYLGLQJFORVLQJRUVHWWOHPHQWVHUYLFHV 352)250$32/,&< 7KH&RPSDQ\PD\SURYLGHDWWKHUHTXHVWRID3URSRVHG,QVXUHGDSURIRUPDSROLF\LOOXVWUDWLQJWKHFRYHUDJHWKDWWKH&RPSDQ\PD\SURYLGH$ SURIRUPDSROLF\QHLWKHUUHIOHFWVWKHVWDWXVRI7LWOHDWWKHWLPHWKDWWKHSURIRUPDSROLF\LVGHOLYHUHGWRD3URSRVHG,QVXUHGQRULVLWDFRPPLWPHQW WRLQVXUH $5%,75$7,21 7KH 3ROLF\ FRQWDLQV DQ DUELWUDWLRQ FODXVH $OO DUELWUDEOH PDWWHUV ZKHQ WKH 3URSRVHG 3ROLF\ $PRXQW LV 7ZR 0LOOLRQ $QG 1R 'ROODUV RUOHVVVKDOOEHDUELWUDWHGDWWKHRSWLRQRIHLWKHUWKH&RPSDQ\RUWKH3URSRVHG,QVXUHGDVWKHH[FOXVLYHUHPHG\RIWKHSDUWLHV$ 3URSRVHG,QVXUHGPD\UHYLHZDFRS\RIWKHDUELWUDWLRQUXOHVDW KWWS ZZZDOWDRUJDUELWUDWLRQ (1'2)&21',7,216 (;&+$1*(6(59,&(6 ,I\RXUWUDQVDFWLRQLQYROYHVDWD[GHIHUUHGH[FKDQJHZHRIIHUWKLVVHUYLFHWKURXJKRXUGLYLVLRQ,3;$V WKHQDWLRQ VODUJHVWFRPSDQ\,3;RIIHUVJXLGDQFHDQGH[SHUWLVH6HFXULW\IRU([FKDQJHIXQGVLQFOXGHV VHJUHJDWHGEDQNDFFRXQWVDQGDPLOOLRQGROODU)LGHOLW\%RQG)LGHOLW\1DWLRQDO7LWOH*URXSDOVRSURYLGHVD PLOOLRQGROODU3HUIRUPDQFH*XDUDQW\IRUHDFK([FKDQJH)RUDGGLWLRQDOLQIRUPDWLRQRUWRVHWXSDQ([FKDQJH SOHDVHFDOO6FRWW1DWKDQVRQDW RU$QQD%DUVN\DW :LUH)UDXG$OHUW 3DJH 2ULJLQDO(IIHFWLYH'DWH &XUUHQW9HUVLRQ'DWH '.:,5( '6,5HY 70DQG)LGHOLW\1DWLRQDO)LQDQFLDO,QFDQGRUDQDIILOLDWH$OOULJKWVUHVHUYHG :,5()5$8'$/(57 7KLV1RWLFHLVQRWLQWHQGHGWRSURYLGHOHJDORUSURIHVVLRQDODGYLFH ,I\RXKDYHDQ\TXHVWLRQVSOHDVHFRQVXOWZLWKDODZ\HU $OOSDUWLHVWRDUHDOHVWDWHWUDQVDFWLRQDUHWDUJHWVIRUZLUHIUDXGDQGPDQ\KDYHORVWKXQGUHGVRIWKRXVDQGVRI GROODUVEHFDXVHWKH\VLPSO\UHOLHGRQWKHZLUHLQVWUXFWLRQVUHFHLYHGYLDHPDLOZLWKRXWIXUWKHUYHULILFDWLRQ,IIXQGV DUHWREHZLUHGLQFRQMXQFWLRQZLWKWKLVUHDOHVWDWHWUDQVDFWLRQZHVWURQJO\UHFRPPHQGYHUEDOYHULILFDWLRQ RIZLUHLQVWUXFWLRQVWKURXJKDNQRZQWUXVWHGSKRQHQXPEHUSULRUWRVHQGLQJIXQGV ,Q DGGLWLRQ WKH IROORZLQJ QRQH[FOXVLYH VHOISURWHFWLRQ VWUDWHJLHV DUH UHFRPPHQGHG WR PLQLPL]H H[SRVXUH WR SRVVLEOHZLUHIUDXG x 1(9(55(/<RQHPDLOVSXUSRUWLQJWRFKDQJHZLUHLQVWUXFWLRQV3DUWLHVWRDWUDQVDFWLRQUDUHO\FKDQJHZLUH LQVWUXFWLRQVLQWKHFRXUVHRIDWUDQVDFWLRQ x $/:$<69(5,)<ZLUHLQVWUXFWLRQVVSHFLILFDOO\WKH$%$URXWLQJQXPEHUDQGDFFRXQWQXPEHUE\FDOOLQJWKH SDUW\ZKRVHQWWKHLQVWUXFWLRQVWR\RX'2127XVHWKHSKRQHQXPEHUSURYLGHGLQWKHHPDLOFRQWDLQLQJWKH LQVWUXFWLRQVXVHSKRQHQXPEHUV\RXKDYHFDOOHGEHIRUHRUFDQRWKHUZLVHYHULI\2EWDLQWKHQXPEHURI UHOHYDQWSDUWLHVWRWKHWUDQVDFWLRQDVVRRQDVDQHVFURZDFFRXQWLVRSHQHG'2127VHQGDQHPDLOWR YHULI\DVWKHHPDLODGGUHVVPD\EHLQFRUUHFWRUWKHHPDLOPD\EHLQWHUFHSWHGE\WKHIUDXGVWHU x 86(&203/(;(0$,/3$66:25'6 WKDWHPSOR\DFRPELQDWLRQRIPL[HGFDVHQXPEHUVDQGV\PEROV 0DNH\RXUSDVVZRUGVJUHDWHUWKDQHLJKW FKDUDFWHUV$OVRFKDQJH\RXUSDVVZRUGRIWHQDQGGR127UHXVH WKHVDPHSDVVZRUGIRURWKHURQOLQHDFFRXQWV x 86(08/7,)$&725$87+(17,&$7,21 IRU HPDLO DFFRXQWV <RXU HPDLOSURYLGHU RU ,7 VWDII PD\ KDYH VSHFLILFLQVWUXFWLRQVRQKRZWRLPSOHPHQWWKLVIHDWXUH )RUPRUHLQIRUPDWLRQRQZLUHIUDXGVFDPVRUWRUHSRUWDQLQFLGHQWSOHDVHUHIHUWRWKHIROORZLQJOLQNV )HGHUDO%XUHDXRI,QYHVWLJDWLRQ ,QWHUQHW&ULPH&RPSODLQW&HQWHU KWWS ZZZIELJRY KWWS ZZZLFJRY 3ULYDF\6WDWHPHQW 3ULQWHG # $0E\ ,/'GRF 3DJH ,/&7)68%'. ),'(/,7<1$7,21$/),1$1&,$/ 35,9$&<127,&( (IIHFWLYH-DQXDU\ )LGHOLW\1DWLRQDO)LQDQFLDO,QFDQGLWVPDMRULW\RZQHGVXEVLGLDU\FRPSDQLHV FROOHFWLYHO\)1)RXURUZH UHVSHFWDQGDUHFRPPLWWHGWRSURWHFWLQJ\RXUSULYDF\7KLV3ULYDF\1RWLFHH[SODLQVKRZZHFROOHFWXVHDQG SURWHFWSHUVRQDOLQIRUPDWLRQZKHQDQGWRZKRPZHGLVFORVHVXFKLQIRUPDWLRQDQGWKHFKRLFHV\RXKDYHDERXW WKHXVHDQGGLVFORVXUHRIWKDWLQIRUPDWLRQ $OLPLWHGQXPEHURI)1)VXEVLGLDULHVKDYHWKHLURZQSULYDF\QRWLFHV,IDVXEVLGLDU\KDVLWVRZQSULYDF\QRWLFHWKH SULYDF\QRWLFHZLOOEHDYDLODEOHRQWKHVXEVLGLDU\ VZHEVLWHDQGWKLV3ULYDF\1RWLFHGRHVQRWDSSO\ &ROOHFWLRQRI3HUVRQDO,QIRUPDWLRQ )1)PD\FROOHFWWKHIROORZLQJFDWHJRULHVRI3HUVRQDO,QIRUPDWLRQ x FRQWDFWLQIRUPDWLRQ HJQDPHDGGUHVVSKRQHQXPEHUHPDLODGGUHVV x GHPRJUDSKLFLQIRUPDWLRQ HJGDWHRIELUWKJHQGHUPDULWDOVWDWXV x LGHQWLW\LQIRUPDWLRQ HJ6RFLDO6HFXULW\1XPEHUGULYHU VOLFHQVHSDVVSRUWRURWKHUJRYHUQPHQW,'QXPEHU x ILQDQFLDODFFRXQWLQIRUPDWLRQ HJORDQRUEDQNDFFRXQWLQIRUPDWLRQ DQG x RWKHUSHUVRQDOLQIRUPDWLRQQHFHVVDU\WRSURYLGHSURGXFWVRUVHUYLFHVWR\RX :HPD\FROOHFW3HUVRQDO,QIRUPDWLRQDERXW\RXIURP x LQIRUPDWLRQZHUHFHLYHIURP\RXRU\RXUDJHQW x LQIRUPDWLRQDERXW\RXUWUDQVDFWLRQVZLWK)1)RXUDIILOLDWHVRURWKHUV DQG x LQIRUPDWLRQZHUHFHLYHIURPFRQVXPHUUHSRUWLQJDJHQFLHVDQGRUJRYHUQPHQWDOHQWLWLHVHLWKHUGLUHFWO\IURP WKHVHHQWLWLHVRUWKURXJKRWKHUV &ROOHFWLRQRI%URZVLQJ,QIRUPDWLRQ )1)DXWRPDWLFDOO\FROOHFWVWKHIROORZLQJW\SHVRI%URZVLQJ,QIRUPDWLRQZKHQ\RXDFFHVVDQ)1)ZHEVLWHRQOLQH VHUYLFHRUDSSOLFDWLRQ HDFKDQ)1):HEVLWH IURP\RXU,QWHUQHWEURZVHUFRPSXWHUDQGRUGHYLFH x ,QWHUQHW3URWRFRO ,3 DGGUHVVDQGRSHUDWLQJV\VWHP x EURZVHUYHUVLRQODQJXDJHDQGW\SH x GRPDLQQDPHV\VWHPUHTXHVWV DQG x EURZVLQJKLVWRU\RQWKH)1):HEVLWHVXFKDVGDWHDQGWLPHRI\RXUYLVLWWRWKH)1):HEVLWHDQGYLVLWVWRWKH SDJHVZLWKLQWKH)1):HEVLWH /LNHPRVWZHEVLWHVRXUVHUYHUVDXWRPDWLFDOO\ORJHDFKYLVLWRUWRWKH)1):HEVLWHDQGPD\FROOHFWWKH%URZVLQJ ,QIRUPDWLRQ GHVFULEHG DERYH :H XVH %URZVLQJ ,QIRUPDWLRQ IRU V\VWHP DGPLQLVWUDWLRQWURXEOHVKRRWLQJIUDXG LQYHVWLJDWLRQDQGWRLPSURYHRXUZHEVLWHV%URZVLQJ,QIRUPDWLRQJHQHUDOO\GRHVQRWUHYHDODQ\WKLQJSHUVRQDO DERXW\RXWKRXJKLI\RXKDYHFUHDWHGDXVHUDFFRXQWIRUDQ)1):HEVLWHDQGDUHORJJHGLQWRWKDWDFFRXQWWKH )1):HEVLWHPD\EHDEOHWROLQNFHUWDLQEURZVLQJDFWLYLW\WR\RXUXVHUDFFRXQW 2WKHU2QOLQH6SHFLILFV &RRNLHV:KHQ\RXYLVLWDQ)1):HEVLWHDFRRNLHPD\EHVHQWWR\RXUFRPSXWHU$FRRNLHLVDVPDOOSLHFHRI GDWDWKDWLVVHQWWR\RXU,QWHUQHWEURZVHUIURPDZHEVHUYHUDQGVWRUHGRQ\RXUFRPSXWHU VKDUGGULYH,QIRUPDWLRQ JDWKHUHGXVLQJFRRNLHVKHOSVXVLPSURYH\RXUXVHUH[SHULHQFH)RUH[DPSOHDFRRNLHFDQKHOSWKHZHEVLWHORDG SURSHUO\RUFDQFXVWRPL]HWKHGLVSOD\SDJHEDVHGRQ\RXUEURZVHUW\SHDQGXVHUSUHIHUHQFHV<RXFDQFKRRVH ZKHWKHURUQRWWRDFFHSWFRRNLHVE\FKDQJLQJ\RXU,QWHUQHWEURZVHUVHWWLQJV%HDZDUHWKDWGRLQJVRPD\LPSDLU RUOLPLWVRPHIXQFWLRQDOLW\RIWKH)1):HEVLWH :HE%HDFRQV:HXVHZHEEHDFRQVWRGHWHUPLQHZKHQDQGKRZPDQ\WLPHVDSDJHKDVEHHQYLHZHG7KLV LQIRUPDWLRQLVXVHGWRLPSURYHRXUZHEVLWHV 'R1RW7UDFN&XUUHQWO\RXU)1):HEVLWHVGRQRWUHVSRQGWR'R1RW7UDFNIHDWXUHVHQDEOHGWKURXJK\RXU EURZVHU 3ULYDF\6WDWHPHQW 3ULQWHG # $0E\ ,/'GRF 3DJH ,/&7)68%'. /LQNVWR2WKHU6LWHV)1):HEVLWHVPD\FRQWDLQOLQNVWRXQDIILOLDWHGWKLUGSDUW\ZHEVLWHV)1)LVQRWUHVSRQVLEOH IRUWKHSULYDF\SUDFWLFHVRUFRQWHQWRIWKRVHZHEVLWHV:HUHFRPPHQGWKDW\RXUHDGWKHSULYDF\SROLF\RIHYHU\ ZHEVLWH\RXYLVLW 8VHRI3HUVRQDO,QIRUPDWLRQ )1)XVHV3HUVRQDO,QIRUPDWLRQIRUWKUHHPDLQSXUSRVHV x 7RSURYLGHSURGXFWVDQGVHUYLFHVWR\RXRULQFRQQHFWLRQZLWKDWUDQVDFWLRQLQYROYLQJ\RX x 7RLPSURYHRXUSURGXFWVDQGVHUYLFHV x 7RFRPPXQLFDWHZLWK\RXDERXWRXURXUDIILOLDWHV DQGRWKHUV SURGXFWVDQGVHUYLFHVMRLQWO\RULQGHSHQGHQWO\ :KHQ,QIRUPDWLRQ,V'LVFORVHG :HPD\GLVFORVH\RXU3HUVRQDO,QIRUPDWLRQDQG%URZVLQJ,QIRUPDWLRQLQWKHIROORZLQJFLUFXPVWDQFHV x WRHQDEOHXVWRGHWHFWRUSUHYHQWFULPLQDODFWLYLW\IUDXGPDWHULDOPLVUHSUHVHQWDWLRQRUQRQGLVFORVXUH x WRQRQDIILOLDWHGVHUYLFHSURYLGHUVZKRSURYLGHRUSHUIRUPVHUYLFHVRUIXQFWLRQVRQRXUEHKDOIDQGZKRDJUHHWR XVHWKHLQIRUPDWLRQRQO\WRSURYLGHVXFKVHUYLFHVRUIXQFWLRQV x WRQRQDIILOLDWHGWKLUGSDUW\VHUYLFHSURYLGHUVZLWKZKRPZHSHUIRUPMRLQWPDUNHWLQJSXUVXDQWWRDQDJUHHPHQW ZLWKWKHPWRMRLQWO\PDUNHWILQDQFLDOSURGXFWVRUVHUYLFHVWR\RX x WRODZHQIRUFHPHQWRUDXWKRULWLHVLQFRQQHFWLRQZLWKDQLQYHVWLJDWLRQRULQUHVSRQVHWRDVXESRHQDRUFRXUW RUGHU RU x LQWKHJRRGIDLWKEHOLHIWKDWVXFKGLVFORVXUHLVQHFHVVDU\WRFRPSO\ZLWKOHJDOSURFHVVRUDSSOLFDEOHODZVRUWR SURWHFWWKHULJKWVSURSHUW\RUVDIHW\RI)1)LWVFXVWRPHUVRUWKHSXEOLF 7KHODZGRHVQRWUHTXLUH\RXUSULRUDXWKRUL]DWLRQDQGGRHVQRWDOORZ\RXWRUHVWULFWWKHGLVFORVXUHVGHVFULEHG DERYH$GGLWLRQDOO\ZHPD\GLVFORVH\RXULQIRUPDWLRQWRWKLUGSDUWLHVIRUZKRP\RXKDYHJLYHQXVDXWKRUL]DWLRQRU FRQVHQWWRPDNHVXFKGLVFORVXUH:HGRQRWRWKHUZLVHVKDUH\RXU3HUVRQDO,QIRUPDWLRQRU%URZVLQJ,QIRUPDWLRQ ZLWKQRQDIILOLDWHGWKLUGSDUWLHVH[FHSWDVUHTXLUHGRUSHUPLWWHGE\ODZ:HPD\VKDUH\RXU3HUVRQDO,QIRUPDWLRQ ZLWK DIILOLDWHV RWKHU FRPSDQLHV RZQHG E\ )1) WR GLUHFWO\ PDUN HW WR \RX 3OHDVH VHH &KRLFHV ZLWK <RXU ,QIRUPDWLRQWROHDUQKRZWRUHVWULFWWKDWVKDULQJ :HUHVHUYHWKHULJKWWRWUDQVIHU\RXU3HUVRQDO,QIRUPDWLRQ%URZVLQJ,QIRUPDWLRQDQGDQ\RWKHULQIRUPDWLRQLQ FRQQHFWLRQZLWKWKHVDOHRURWKHUGLVSRVLWLRQRIDOORUSDUWRIWKH)1)EXVLQHVVDQGRUDVVHWVRULQWKHHYHQWRI EDQNUXSWF\UHRUJDQL]DWLRQLQVROYHQF\UHFHLYHUVKLSRUDQDVVLJQPHQWIRUWKHEHQHILWRIFUHGLWRUV%\VXEPLWWLQJ 3HUVRQDO,QIRUPDWLRQDQGRU%URZVLQJ,QIRUPDWLRQWR)1)\RXH[SUHVVO\DJUHHDQGFRQVHQWWRWKHXVHDQGRU WUDQVIHURIWKHIRUHJRLQJLQIRUPDWLRQLQFRQQHFWLRQZLWKDQ\RIWKHDERYHGHVFULEHGSURFHHGLQJV 6HFXULW\RI<RXU,QIRUPDWLRQ :HPDLQWDLQSK\VLFDOHOHFWURQLFDQGSURFHGXUDOVDIHJXDUGVWRSURWHFW\RXU3HUVRQDO,QIRUPDWLRQ &KRLFHV:LWK<RXU,QIRUPDWLRQ ,I\RXGRQRWZDQW)1)WRVKDUH\RXULQIRUPDWLRQDPRQJRXUDIILOLDWHVWRGLUHFWO\PDUNHWWR\RX\RXPD\VHQGDQ RSWRXWUHTXHVWDVGLUHFWHGDWWKHHQGRIWKLV3ULYDF\1RWLFH:HGRQRWVKDUH\RXU3HUVRQDO,QIRUPDWLRQZLWK QRQDIILOLDWHVIRUWKHLUXVHWRGLUHFWPDUNHWWR\RXZLWKRXW\RXUFRQVHQW :KHWKHU\RXVXEPLW3HUVRQDO,QIRUPDWLRQRU%URZVLQJ,QIRUPDWLRQWR)1)LVHQWLUHO\XSWR\RX,I\RXGHFLGHQRW WR VXEPLW 3HUVRQDO ,QIRUPDWLRQ RU %URZVLQJ ,QIRUPDWLRQ )1) PD\ QRW EH DEOH WR SURYLGH FHUWDLQ VHUYLFHV RU SURGXFWVWR\RX )RU&DOLIRUQLD5HVLGHQWV :HZLOOQRWVKDUH\RXU3HUVRQDO,QIRUPDWLRQRU%URZVLQJ,QIRUPDWLRQZLWKQRQDIILOLDWHG WKLUGSDUWLHVH[FHSWDVSHUPLWWHGE\&DOLIRUQLDODZ)RUDGGLWLRQDOLQIRUPDWLRQDERXW\RXU&DOLIRUQLDSULYDF\ULJKWV SOHDVH YLVLW WKH &DOLIRUQLD 3ULYDF\ OLQN RQ RXU ZHEVLWH KWWSV IQIFRPSDJHVFDOLIRUQLDSULYDF\DVS[ RU FDOO )RU1HYDGD5HVLGHQWV <RXPD\EHSODFHGRQRXULQWHUQDO'R1RW&DOO/LVWE\FDOOLQJ RUE\ FRQWDFWLQJXVYLDWKHLQIRUPDWLRQVHWIRUWKDWWKHHQGRIWKLV3ULYDF\1RWLFH1HYDGDODZUHTXLUHVWKDWZHDOVR SURYLGH \RX ZLWK WKH IROORZLQJ FRQWDFW LQIRUPDWLRQ %XUHDX RI&RQVXPHU 3URWHFWLRQ 2IILFH RI WKH 1HYDGD $WWRUQH\*HQHUDO(:DVKLQJWRQ6W6XLWH /DV9HJDV19 3KRQHQXPEHU HPDLO %&3,1)2#DJVWDWHQYXV 3ULYDF\6WDWHPHQW 3ULQWHG # $0E\ ,/'GRF 3DJH ,/&7)68%'. )RU2UHJRQ5HVLGHQWV :HZLOOQRWVKDUH\RXU3HUVRQDO,QIRUPDWLRQRU%URZVLQJ,QIRUPDWLRQZLWKQRQDIILOLDWHG WKLUGSDUWLHVIRUPDUNHWLQJSXUSRVHVH[FHSWDIWHU\RXKDYHEHHQLQIRUPHGE\XVRIVXFKVKDULQJDQGKDGDQ RSSRUWXQLW\WRLQGLFDWHWKDW\RXGRQRWZDQWDGLVFORVXUHPDGHIRUPDUNHWLQJSXUSRVHV )RU9HUPRQW5HVLGHQWV :HZLOOQRWGLVFORVHLQIRUPDWLRQDERXW\RXUFUHGLWZRUWKLQHVVWRRXUDIILOLDWHVDQGZLOOQRW GLVFORVH\RXUSHUVRQDOLQIRUPDWLRQILQDQFLDOLQIRUPDWLRQFUHGLWUHSRUWRUKHDOWKLQIRUPDWLRQWRQRQDIILOLDWHGWKLUG SDUWLHV WR PDUNHW WR \RX RWKHU WKDQ DV SHUPLWWHG E\ 9HUPRQW ODZ XQOHVV \RX DXWKRUL]H XV WR PDNH WKRVH GLVFORVXUHV ,QIRUPDWLRQ)URP&KLOGUHQ 7KH)1):HEVLWHVDUHQRWLQWHQGHGRUGHVLJQHGWRDWWUDFWSHUVRQVXQGHUWKHDJHRIHLJKWHHQ :HGR QRW FROOHFW3HUVRQDO,QIRUPDWLRQIURPDQ\SHUVRQWKDWZHNQRZWREHXQGHUWKHDJHRIWKLUWHHQ ZLWKRXWSHUPLVVLRQ IURPDSDUHQWRUJXDUGLDQ ,QWHUQDWLRQDO8VHUV )1) VKHDGTXDUWHUVLVORFDWHGZLWKLQWKH8QLWHG6WDWHV,I\RXUHVLGHRXWVLGHWKH8QLWHG6WDWHVDQGFKRRVHWR SURYLGH3HUVRQDO,QIRUPDWLRQRU%URZVLQJ,QIRUPDWLRQWRXVSOHDVHQRWHWKDWZHPD\WUDQVIHUWKDWLQIRUPDWLRQ RXWVLGH RI \RXU FRXQWU\ RI UHVLGHQFH %\ SURYLGLQJ )1) ZLWK \RXU 3HUVRQDO ,QIRUPDWLRQ DQGRU %URZVLQJ ,QIRUPDWLRQ\RXFRQVHQWWRRXUFROOHFWLRQWUDQVIHUDQGXVHRIVXFKLQIRUPDWLRQLQDFFRUGDQFHZLWKWKLV3ULYDF\ 1RWLFH )1):HEVLWH6HUYLFHVIRU0RUWJDJH/RDQV &HUWDLQ )1) FRPSDQLHV SURYLGH VHUYLFHV WR PRUWJDJH ORDQ VHUYLFHUV LQFOXGLQJ KRVWLQJ ZHEVLWHV WKDW FROOHFW FXVWRPHULQIRUPDWLRQRQEHKDOIRIPRUWJDJHORDQVHUYLFHUV WKH6HUYLFH:HEVLWHV 7KH6HUYLFH:HEVLWHVPD\ FRQWDLQOLQNVWRERWKWKLV3ULYDF\1RWLFHDQGWKHPRUWJDJHORDQVHUYLFHURUOHQGHU VSULYDF\QRWLFH7KHVHFWLRQVRI WKLV 3ULYDF\ 1RWLFH WLWOHG :KHQ ,QIRUPDWLRQ LV 'LVFORVHG &KRLFHV ZLWK <RXU ,QIRUPDWLRQ DQG $FFHVVLQJ DQG &RUUHFWLQJ,QIRUPDWLRQGRQRWDSSO\WRWKH6HUYLFH:HEVLWHV7KHPRUWJDJHORDQVHUYLFHURUOHQGHU VSULYDF\ QRWLFH JRYHUQV XVH GLVFORVXUH DQG DFFHVV WR \RXU 3HUVRQDO ,QIRUPDWLRQ )1) GRHV QRW VKDUH 3HUVRQDO ,QIRUPDWLRQ FROOHFWHG WKURXJK WKH 6HUYLFH :HEVLWHV H[FHSW DV UHTXLUHG RU DXWKRUL]HG E\ FRQWUDFW ZLWK WKH PRUWJDJH ORDQ VHUYLFHU RU OHQGHU RU DV UHTXLUHG E\ ODZ RU LQ WKH JRRGIDLWK EHOLHI WKDW VXFK GLVFORVXUH LV QHFHVVDU\ WRFRPSO\ZLWKDOHJDOSURFHVVRUDSSOLFDEOHODZWRHQIRUFHWKLV3ULYDF\1RWLFHRUWRSURWHFWWKHULJKWV SURSHUW\RUVDIHW\RI)1)RUWKHSXEOLF <RXU&RQVHQW7R7KLV3ULYDF\1RWLFH 1RWLFH&KDQJHV 8VHRI&RPPHQWVRU)HHGEDFN %\VXEPLWWLQJ3HUVRQDO,QIRUPDWLRQDQGRU%URZVLQJ,QIRUPDWLRQWR)1)\RXFRQVHQWWRWKHFROOHFWLRQDQGXVHRI WKHLQIRUPDWLRQLQDFFRUGDQFHZLWKWKLV3ULYDF\1RWLFH:HPD\FKDQJHWKLV3ULYDF\1RWLFHDWDQ\WLPH7KH 3ULYDF\1RWLFH V HIIHFWLYH GDWH ZLOOVKRZ WKH ODVW GDWH FKDQJHVZHUHPDGH,I\RXSURYLGHLQIRUPDWLRQWRXV IROORZLQJDQ\FKDQJHRIWKH3ULYDF\1RWLFHWKDWVLJQLILHV\RXUDVVHQWWRDQGDFFHSWDQFHRIWKHFKDQJHVWRWKH 3ULYDF\1RWLFH $FFHVVLQJDQG&RUUHFWLQJ,QIRUPDWLRQ &RQWDFW8V ,I\RXKDYHTXHVWLRQVZRXOGOLNHWRFRUUHFW\RXU3HUVRQDO,QIRUPDWLRQRUZDQWWRRSWRXWRILQIRUPDWLRQVKDULQJIRU DIILOLDWHPDUNHWLQJYLVLW)1) V 2SW2XW3DJHRUFRQWDFWXVE\SKRQHDW RUE\PDLOWR )LGHOLW\1DWLRQDO)LQDQFLDO,QF 5LYHUVLGH$YHQXH -DFNVRQYLOOH)ORULGD $WWQ &KLHI3ULYDF\2IILFHU 'HFRPPLVVLRQLQJ(VWLPDWH3ODQ 'DWH &DOFXODWHG%\ &* %HHFKHU5RDG <RUNYLOOH,/ 7KHIROORZLQJYDOXHVZHUHXVHGLQWKLV'HFRPPLVVLRQLQJ(VWLPDWH 6\VWHP6SHFLILFDWLRQV (TXLSPHQW 0DWHULDO5HPRYDO5DWHV 1XPEHURI0RGXOHV 0RGXOH5HPRYDO5DWH PLQPRGXOH /LQHDU)HHWRI5DFNLQJ IW 5DFN:LULQJ5HP5DWH PLQPRG 1XPEHURI,QYHUWHUV 5DFNLQJ'LVPDQWOLQJ5DWH PLQ/) 1XPEHURI7UDQVIRUPHUV ,QYHUWHU5HPRYDO5DWH KUXQLW 1XPEHURI7UDFNHU0RWRUV 7UDQVIRUPHU5HPRYDO5DWH KUXQLW (OHFWULFDO:LULQJ/HQJWK IW 0RWRU5HPRYDO5DWH KUXQLW 1XPEHURI)RXQGDWLRQ3LOHV 5DFN/RDGLQJ5DWH PLQ/) /HQJWKRI3HULPHWHU)HQFH IW (OHFW:LULQJ5HPRYDO5DWH PLQ/) 1XPEHURI3RZHU3ROHV 3LOH5HP5DWH SLOHVGD\ $FFHVV5G0DWHULDO9ROXPH <' )HQFH5HPRYDO5DWH PLQ/) 7RWDO'LVWXUEHG$UHD 6) 'D\VUHTWREUHDNXSFRQFUHWHSDGV 7RWDO)HQFH:HLJKW OEV 'D\VUHTZLWK5RXJK*UDGHU 7RWDO5DFNLQJ:HLJKW OEV 'D\VUHTZLWK)LQH*UDGHU 7RWDO)RXQGDWLRQ3LOH:HLJKW OEV 7RWDO7UXFNORDGV5HTXLUHG 5RXQG7ULS'LVWWR7UDQV6WD PLOHV 5RXQG7ULS7LPHWR7UDQV6WD KU /DERUDQG(TXLSPHQW&RVWV /DERU5DWH KU 2SHUDWRU5DWH KU %REFDW&RVW KU )URQW(QG/RDGHU&RVW 'D\ ([FDYDWRU&RVW 'D\ 7UXFNLQJ&RVW KU 1XPEHURI(QHUJ\6WRUDJH8QLWV %DFNKRH&RVW KU %DWWHU\'LVSRVDO)HH 3RZHU3ROH5HPRYDO&RVW SROH %DWWHU\/RDGLQJ3UHS7LPH KU *UDGHU&RVW GD\ %DWWHU\/RDGLQJ7LPH KU *UDYHO([SRUW&RVW <' /RDP,PSRUW&RVW <' 6HHGLQJ&RVW 6) )XHO&RVW PLOH 7KLV'HFRPPLVVLRQLQJ(VWLPDWHKDVEHHQSUHSDUHGE\1HZ/HDI(QHUJ\LQDQDWWHPSWWRSUHGLFWWKHFRVW DVVRFLDWHGZLWKWKHUHPRYDORIWKHSURSRVHGVRODUIDFLOLW\7KHSULPDU\FRVWRIGHFRPPLVVLRQLQJLVWKHODERUWR GLVPDQWOHDQGORDGDVZHOODVWKHFRVWRIWUXFNLQJDQGHTXLSPHQW$OOPDWHULDOZLOOEHUHPRYHGIURPWKHVLWH LQFOXGLQJWKHFRQFUHWHHTXLSPHQWSDGVZKLFKZLOOEHEURNHQXSDWWKHVLWHDQGKDXOHGWRWKHQHDUHVWWUDQVIHU VWDWLRQ 1RVDOYDJHYDOXHVKDYHEHHQDVVXPHGLQWKLVFDOFXODWLRQ (QHUJ\6WRUDJH'HFRPPLVVLRQLQJ %HHFKHU5RDG <RUNYLOOH,/ /DERU0DWHULDODQG(TXLSPHQW&RVWV 5HPRYH0RGXOHV 7RWDO 5HPRYH5DFN:LULQJ 7RWDO 'LVPDQWOH5DFNV 7RWDO 5HPRYHDQG/RDG(OHFWULFDO(TXLSPHQW 7RWDO %UHDN8S&RQFUHWH3DGV 7RWDO &RQFUHWHSDGVDUHEURNHQXSXVLQJDQH[FDYDWRUDQGMDFNKDPPHU Number of Demolition Days (Excavator Cost + Operator Cost) = Total Concrete Pad Removal (Number of Inverters Inverter Removal Rate + Number of Transformers • Transformer Removal Rate + Number of Motors • Motor Removal Rate) • (Operator Rate + Bobcat Cost) = Electrical Equipment Removal Cost 7KHVRODUPRGXOHVDUHIDVWHQHGWRUDFNLQJZLWKFODPSV7KH\VOLGHLQDWUDFN$ODERUHUQHHGV RQO\XQFODPSWKHPRGXOHDQGUHDFKRYHUDQGVOLGHWKHPRGXOHRXWRIWKHWUDFN Module Removal Rate • Total Number of Solar Modules • Labor Rate = Module Removal Cost 7KHPRGXOHVDUHSOXJJHGWRJHWKHULQWKHVDPHPDQQHUDVDQHOHFWULFDOFRUGIURPDOLJKWLV SOXJJHGLQWRDZDOOVRFNHW7KHVWULQJZLUHVDUHLQDWUD\$ODERUHUQHHGVRQO\XQSOXJWKH PRGXOHUHDFKLQWRWKHWUD\DQGUHPRYHWKHVWUDQGVRIZLUH Wire Removal Rate Total Number of Solar Modules • Labor Rate = Rack Wiring Removal Cost 7UDFNHUPRGXOHUDFNLQJSULPDULO\FRQVLVWVRIWRUTXHWXEHVDQGDGULYHOLQH7KHVHDUH VXSSRUWHGRQGULYHQSLOHV7KHWRUTXHWXEHVDQGGULYHOLQHXQEROWIURPWKHIRXQGDWLRQSLOHV Linear feet of Racking Rack Dismantling Rate • Labor Rate = Rack Dismantling Cost (OHFWULFDOHTXLSPHQWLQFOXGHVWUDQVIRUPHUVLQYHUWHUVDQGWUDFNHUPRWRUV %HHFKHU5RDG <RUNYLOOH,/ /RDG5DFNV 7RWDO 5HPRYH(OHFWULFDO:LULQJ 7RWDO 5HPRYH)RXQGDWLRQ3LOHV 7RWDO 5HPRYH)HQFLQJ 7RWDO 5HPRYH3RZHU3ROHV 7RWDO Number of Power Poles Pole Removal cost = Total Power Pole Removal Cost 2QFHWKHUDFNLQJKDVEHHQGLVPDQWOHGLWZLOOEHORDGHGRQWRWUXFNVIRUUHPRYDOIURPWKHVLWH 7KHWUXFNLQJFRVWDVVRFLDWHGZLWKWKLVOLQHLWHPUHSUHVHQWVWKHDGGLWLRQDOWLPHDWUXFNZLOOEH QHHGHGGXULQJORDGLQJ3OHDVHVHHLWHPIRUWKHFRVWRIWUXFNLQJRIIVLWH Linear feet of Racking Rack Loading Rate • (Operator Cost + Front End Loader Cost + Trucking Cost) = Total Rack Removal Cost (OHFWULFDOZLULQJZLOOEHUHPRYHGIURPDOOXQGHUJURXQGFRQGXLWV Cable Length Cable Removal Rate • (Operator Cost + Backhoe Cost) = Total Cable Removal Cost )RXQGDWLRQSLOHVZLOOEHSXOOHGRXWRIWKHJURXQGDQGORDGHGRQWRDWUXFNWREHUHPRYHGIURP VLWH (Total Number of Piles / Daily Pile Removal Rate) • (Operator Rate + Excavator Cost) = Total Pile Removal Cost )HQFLQJSRVWVPHVKDQGIRXQGDWLRQVZLOOEHORDGHGRQWRDWUXFNDQGUHPRYHGIURPVLWH 7UXFNLQJFRVWVLQFOXGHGLQWKLVOLQHLWHPDUHIRUWKHUHPRYDOSURFHVV7UXFNLQJWRDUHF\FOLQJ IDFLOLW\DUHLQFOXGHGLQLWHP (Total Length of Fence • Fence Removal Rate) • (Operator Rate + Bobcat Cost + Trucking Cost) = 3RZHUSROHVZLOOEHUHPRYHGDQGVKLSSHGRIIVLWH %HHFKHU5RDG <RUNYLOOH,/ *UDYHO5RDG5HFODPDWLRQ 7RWDO 6HHG'LVWXUEHG$UHDV 7RWDO 7UXFNWR7UDQVIHU6WDWLRQ 7RWDO 5HPRYHDQG'LVSRVHRI(QHUJ\6WRUDJH(TXLSPHQW 7RWDO 7KHEDWWHU\XQLWVZLOOEHSUHSDUHGIRUVKLSPHQWDQGORDGHGRQWRDWUXFN$GLVSRVDOIHHZLOODOVR EHUHTXLUHGIRUWKHGLVSRVDOFRPSDQ\WRDFFHSWWKHEDWWHULHV Number of Battery Units • ((Loading Prep Time • Labor Cost) + Loading Time • (Labor Rate + Bobcat Cost + Trucking Cost) + Disposal Fee) = Total Energy Storage Removal and Disposal Cost 5HFODPDWLRQRIWKHJUDYHODFFHVVURDGZLOOHQWDLOUHPRYLQJWKHJUDYHOPDWHULDODQGH[SRUWLQJLW RIIVLWH7KHDUHDZLOOWKHQEHEDFNILOOHGZLWKORDPDQGJUDGHG (Days with Rough Grader + Days with Fine Grader) • (Grader Cost per Day+Operator Cost per Day) + [Roadway Material Volume • (Gravel Export Cost + Loam Import Cost)] = Gravel Road Reclamation Cost 6HHGLQJFRVWLQFOXGHVODERUDQGPDWHULDOVIRUUHVHHGLQJDOOGLVWXUEHGDUHDVLQFOXGLQJWKH UHFODLPHGJUDYHOURDGDUHDIRUPHUHOHFWULFDODUHDVDQGDUHDVGLVWXUEHGE\UDFNLQJIRXQGDWLRQ UHPRYDO Seeding Cost • Disturbed Area = Total Seeding Cost $OOPDWHULDOZLOOEHWUXFNHGWRWKHQHDUHVW7UDQVIHUVWDWLRQWKDWDFFHSWVFRQVWUXFWLRQPDWHULDO 7KHQHDUHVWWUDQVIHUVWDWLRQLV*URRW5HF\FOLQJ :DVWH6HUYLFHV (Total Truckloads • Roundtrip Distance • Fuel Cost) + (Total Truckloads • Round Trip Time • Trucking Cost) = Total Trucking Cost to Transfer Station %HHFKHU5RDG <RUNYLOOH,/ 6DOYDJH9DOXHV 6DOYDJH9DOXH1RW,QFOXGHG %HHFKHU5RDG <RUNYLOOH,/ /LQH,WHP 7DVN &RVW 0RGXOH5HPRYDO 5DFN:LULQJ5HPRYDO 5DFN'LVPDQWOLQJ (OHFWULFDO(TXLSPHQW/RDGLQJDQG5HPRYDO %UHDN8S&RQFUHWH3DGV /RDG5DFNV (OHFWULFDO:LULQJ5HPRYDO )RXQGDWLRQ3LOH5HPRYDO )HQFH5HPRYDO 3RZHU3ROH5HPRYDO *UDYHO5RDG5HFODPDWLRQ 6HHG'LVWXUEHG$UHDV 7UXFNLQJWR7UDQVIHU6WDWLRQ (QHUJ\6WRUDJH6\VWHP5HPRYDO 6XEWRWDO $GGLWLRQDO,WHP 9DOXH 6DOYDJH9DOXHV 1RW,QFOXGHG $GGLWLRQDO,WHP6XEWRWDO )XWXUH9DOXH ,QIODWLRQ RI<HDUV ,QIODWLRQ5DWH *UDQG7RWDO Total • (1+ Inflation Rate)^Number of Years =Grand Total 6XPPDU\RI'HFRPPLVVLRQLQJ&RVWVDQG6DOYDJH9DOXHV 7DVN 3UHVHQW9DOXH7RWDO 7DVN Applicant: IDNR Project Number: Address: Contact:Marisa Kolman 21 S. Evergreen Ave, Suite 200 Arlington Heights, IL 60005 Alternate Number: Date: 20220516 Project: Address: Beecher Rd - Kendall County PIN 02-18-400-002 & PIN 02-17-300-002, Kendall County Description:Development of solar energy array 05/25/2022 2213609GreenbergFarrow Natural Resource Review Results Consultation for Endangered Species Protection and Natural Areas Preservation (Part 1075) The Illinois Natural Heritage Database shows the following protected resources may be in the vicinity of the project location: Mottled Sculpin (Cottus bairdii) Mottled Sculpin (Cottus bairdii) An IDNR staff member will evaluate this information and contact you to request additional information or to terminate consultation if adverse effects are unlikely. Location The applicant is responsible for the accuracy of the location submitted for the project. County:Kendall Township, Range, Section: 37N, 7E, 17 37N, 7E, 18 Government Jurisdiction Kendall County Matt Asselmeier 111 West Fox Street Yorkville, Illinois 60560 IL Department of Natural Resources Contact Kyle Burkwald 217-785-5500 Division of Ecosystems & Environment Disclaimer The Illinois Natural Heritage Database cannot provide a conclusive statement on the presence, absence, or condition of natural resources in Illinois. This review reflects the information existing in the Database at the time of this inquiry, and should not be regarded as a final statement on the site being considered, nor should it be a substitute for detailed site surveys or field surveys required for environmental assessments. If additional protected resources are encountered during the project’s implementation, compliance with applicable statutes and regulations is required. Page 1 of 3 Terms of Use By using this website, you acknowledge that you have read and agree to these terms. These terms may be revised by IDNR as necessary. If you continue to use the EcoCAT application after we post changes to these terms, it will mean that you accept such changes. If at any time you do not accept the Terms of Use, you may not continue to use the website. 1. The IDNR EcoCAT website was developed so that units of local government, state agencies and the public could request information or begin natural resource consultations on-line for the Illinois Endangered Species Protection Act, Illinois Natural Areas Preservation Act, and Illinois Interagency Wetland Policy Act. EcoCAT uses databases, Geographic Information System mapping, and a set of programmed decision rules to determine if proposed actions are in the vicinity of protected natural resources. By indicating your agreement to the Terms of Use for this application, you warrant that you will not use this web site for any other purpose. 2. Unauthorized attempts to upload, download, or change information on this website are strictly prohibited and may be punishable under the Computer Fraud and Abuse Act of 1986 and/or the National Information Infrastructure Protection Act. 3. IDNR reserves the right to enhance, modify, alter, or suspend the website at any time without notice, or to terminate or restrict access. Security EcoCAT operates on a state of Illinois computer system. We may use software to monitor traffic and to identify unauthorized attempts to upload, download, or change information, to cause harm or otherwise to damage this site. Unauthorized attempts to upload, download, or change information on this server is strictly prohibited by law. Unauthorized use, tampering with or modification of this system, including supporting hardware or software, may subject the violator to criminal and civil penalties. In the event of unauthorized intrusion, all relevant information regarding possible violation of law may be provided to law enforcement officials. Privacy EcoCAT generates a public record subject to disclosure under the Freedom of Information Act. Otherwise, IDNR uses the information submitted to EcoCAT solely for internal tracking purposes. Page 2 of 3 IDNR Project Number: 2213609 EcoCAT Receipt Project Code 2213609 APPLICANT DATE 5/25/2022 DESCRIPTION CONVENIENCE FEEFEE TOTAL PAID EcoCAT Consultation $ 125.00 $ 2.81 TOTAL PAID Illinois Department of Natural Resources One Natural Resources Way Springfield, IL 62702 217-785-5500 dnr.ecocat@illinois.gov 127.81 127.81 GreenbergFarrow Marisa Kolman 21 S. Evergreen Ave, Suite 200 Arlington Heights, IL 60005 $ $ Page 3 of 3 IDNR Project Number: 2213609 Arlington Heights, IL 60005 RE: Beecher Rd - Kendall County Project Number(s): 2213609 [20220516] County: Kendall Dear Applicant: Kyle Burkwald Division of Ecosystems and Environment 217-785-5500 May 26, 2022 Marisa Kolman GreenbergFarrow 21 S. Evergreen Ave, Suite 200 This letter is in reference to the project you recently submitted for consultation. The natural resource review provided by EcoCAT identified protected resources that may be in the vicinity of the proposed action. The Department has evaluated this information and concluded that adverse effects are unlikely. Therefore, consultation under 17 Ill. Adm. Code Part 1075 is terminated. This consultation is valid for two years unless new information becomes available that was not previously considered; the proposed action is modified; or additional species, essential habitat, or Natural Areas are identified in the vicinity. If the project has not been implemented within two years of the date of this letter, or any of the above listed conditions develop, a new consultation is necessary. The natural resource review reflects the information existing in the Illinois Natural Heritage Database at the time of the project submittal, and should not be regarded as a final statement on the site being considered, nor should it be a substitute for detailed site surveys or field surveys required for environmental assessments. If additional protected resources are encountered during the project’s implementation, you must comply with the applicable statutes and regulations. Also, note that termination does not imply IDNR's authorization or endorsement of the proposed action. Please contact me if you have questions regarding this review. Additionally, the Department recommends the applicant consider participation in the Solar Site Pollinator Scorecard program. More information can be found at the following website: https://www2.illinois.gov/dnr/conservation/PollinatorScoreCard/Pages/default.aspx JB Pritzker, Governor Colleen Callahan, Director 75$160,77$//(77(5 72 *UHHQEHUJ)DUURZ '$7( -XO\ 6RXWK(YHUJUHHQ$YH6WH 352-(&7 %HHFKHU5RDG $UOLQJWRQ+HLJKWV,/ $771 0V0DULVD.ROPDQ PNROPDQ#JUHHQEHUJIDUURZFRP 0V.HUL:LOOLDPV NZLOOLDPV#JUHHQEHUJIDUURZFRP (1&$33URMHFW) :HDUHVHQGLQJ\RX 'DWHRI(QFORVHG 0DWHULDOVRI&RSLHV :HWODQG'HOLQHDWLRQ5HSRUW -XO\ 3') && 'DWHRI(QFORVHG 0DWHULDOVRI&RSLHV 9LD 836*URXQG8362YHUQLJKW860DLO(OHFWURQLF 7+(6($5(75$160,77('$6&+(&.('%(/2:: )RU$SSURYDO$V5HTXHVWHG)RU\RXUUHYLHZ)RU\RXUXVH 5(0$5.6 6LJQHG 6XVDQ5RZOH\3:6&:6/(('$3 VURZOH\#HQFDSLQFQHW :(7/$1''(/,1($7,215(3257 %((&+(552$' %5,672/72:16+,3.(1'$//&2817<,//,12,6 3UHSDUHGIRU *UHHQEHUJ)DUURZ 6RXWK(YHUJUHHQ$YHQXH6XLWH $UOLQJWRQ+HLJKWV,/ $WWQ 0V0DULVD.ROPDQ $WWQ 0V.HUL:LOOLDPV 3UHSDUHGE\ (1&$3,QF 0V6XVDQ5RZOH\3:6&:6/(('$3 'DWH3UHSDUHG -XO\ (1&$3,QF3URMHFW ) :(7/$1''(/,1($7,215(3257 %HHFKHU5RDG*UHHQEHUJ)DUURZ 7DEOHRI&RQWHQWV 3DJH1XPEHU ([HFXWLYH6XPPDU\ 3URMHFW3XUSRVH 0HWKRGV 0DS5HYLHZ 6SHFLILF'HVFULSWLRQRI,GHQWLILHG:DWHU5HVRXUFHV ,QYHVWLJDWLRQRI)DUPHG$UHDVDQG6OLGH$QDO\VLV6XPPDU\ 5HJXODWRU\6WDWHPHQW 5HFRPPHQGDWLRQV 5HIHUHQFHV $WWDFKPHQWV 86):66HFWLRQ&RQVXOW5HYLHZ6XPPDU\2IILFLDO7KUHDWHQHG (QGDQJHUHG6SHFLHV/LVW ,'15(FR&$71DWXUDO5HVRXUFH5HYLHZ5HVXOWV )ORULVWLF4XDOLW\'DWD6KHHWV :HWODQG'HWHUPLQDWLRQ'DWD)RUPV 6LWH3KRWRJUDSKV 86$&($QWHFHGHQW3UHFLSLWDWLRQ7RRO)LJXUH 7DEOHV :(7 +LVWRULFDO$HULDO3KRWRJUDSKV :(7 ([KLELWV $±/RFDWLRQ0DS %±1DWLRQDO:HWODQGV,QYHQWRU\ &±6RLO0DS '±86*67RSRJUDSKLF0DS (±)(0$)ORRG,QVXUDQFH5DWH0DS )±,6+32+$5*,60DS *±$HULDO3KRWRJUDSK :(7/$1''(/,1($7,215(3257 3URMHFW1DPHDQG&OLHQW %HHFKHU5RDG*UHHQEHUJ)DUURZ 3URMHFW1XPEHU ) /RFDWLRQ ,OOLQRLV.HQGDOO&RXQW\%ULVWRO7RZQVKLS3ODQR715(6HFWLRQV /DWLWXGH /RQJLWXGH 'DWHRI6LWH9LVLW -XQH )LHOG,QYHVWLJDWRU 65RZOH\3:6&:6/(('$3 (;(&87,9(6800$5< 7KHSURMHFWDUHD DSSUR[LPDWHO\DFUHVLQVL]H LVORFDWHGLQ3ODQR.HQGDOO&RXQW\,OOLQRLV ([KLELW$ /RFDWLRQ0DS 7KHSURMHFWDUHDDVSUHVHQWHGLQWKLVUHSRUWUHSUHVHQWVWKHSURSHUW\ OLPLWVLQYHVWLJDWHGE\(1&$3,QFIRUWKHSUHVHQFHRIUHJXODWHGVXUIDFHZDWHUUHVRXUFHV7KHVH OLPLWVGRQRWQHFHVVDULO\UHIOHFWWKHERXQGDULHVRIDQ\SURSRVHGGHYHORSPHQWDFWLYLWLHV7KH SURMHFWDUHDLVJHQHUDOO\ERXQGHGE\DJULFXOWXUDOILHOGVWRWKHQRUWK%XUOLQJWRQ1RUWKHUQ6DQWD )H %16) 5DLOURDGOLQHWRWKHVRXWK5RE5R\&UHHNWRWKHHDVWDQG%HHFKHU5RDGWRWKH ZHVW7KHSURMHFWDUHDLVORFDWHGZLWKLQWKH)R[5LYHUZDWHUVKHG 7KHSURMHFWDUHDFRQVLVWVRIDJULFXOWXUDOODQGXVHGIRUWKHSURGXFWLRQRIURZFURSVPRVWUHFHQWO\ SODQWHGZLWK&RUQ Zea mays 5RE5R\&UHHNDQGLWVDVVRFLDWHGZHWODQGLVORFDWHGHDVWRIWKH VLWH7KHVLWHGRHVQRWFRQWDLQDQ\EXLOGLQJVRUVWUXFWXUHV7KHWRSRJUDSK\RIWKHVLWHLVJHQWO\ UROOLQJ 7ZR IDUPHG ZHWODQGV WRWDOLQJ DFUHV ZHUH LGHQWLILHG RQ WKHSURMHFW DUHD 2QH RIIVLWH ZHWODQG5RE5R\&UHHNZHUHLGHQWLILHGHDVWRIWKHVLWH7KHOLPLWVRIIDUPHGZHWODQGVZHUH LGHQWLILHGXVLQJSURWRFROHVWDEOLVKHGE\WKH86'HSDUWPHQWRI$JULFXOWXUHDQGZHUHQRWILHOG VWDNHG7KHERXQGDULHVRIWKHWZRIDUPHGZHWODQGVPXVWEHVFDOHGIURPWKH$HULDO3KRWRJUDSK RQWRDVLWHVXUYH\ %DVLF LQIRUPDWLRQ UHJDUGLQJ ZHWODQG UHJXODWLRQV PD\ EH IRXQG LQ WKH 5HJXODWRU\ 6WDWHPHQW SRUWLRQRIWKLVUHSRUW%ULHIO\WKH86$UP\&RUSVRI(QJLQHHUV 86$&( UHJXODWHVDOO:DWHUV RI WKH 8QLWHG 6WDWHV WKDW DUH FXUUHQWO\ RU KLVWRULFDOO\ QDYLJDEOH DQG DOO ZHWODQGV WKDW DUH FRQQHFWHGWRRUDVVRFLDWHGZLWKWKHVH7KH.HQGDOO&RXQW\6WRUPZDWHU0DQDJHPHQW2UGLQDQFH SURYLGHVIRUWKHSURWHFWLRQRIZHWODQGVDQGRWKHUGHSUHVVLRQDOVWRUDJHDUHDVIURPGDPDJLQJ PRGLILFDWLRQV DQG DGYHUVH FKDQJHV LQ UXQRII TXDOLW\ DQG TXDQWLW\ DVVRFLDWHG ZLWK ODQG GHYHORSPHQWV ,W DSSHDUV WKDW )DUPHG :HWODQGV DQG DUH LVRODWHG DQG WKHUHIRUH QRW UHJXODWHG IHGHUDOO\ E\ WKH 86$&( )DUPHG :HWODQGV DQG ZLOOEH UHJXODWHG E\ .HQGDOO &RXQW\2II6LWH:HWODQG5RE5R\&UHHNZLOOEHFRQVLGHUHGIHGHUDOO\MXULVGLFWLRQDOGXHWRLWV HYHQWXDOFRQQHFWLRQWRWKH)R[5LYHUGRZQVWUHDP7KH86$&(ZLOOQRWHQIRUFHDEXIIHUXQOHVV ZHWODQGLPSDFWVDUHSURSRVHGE\WKHGHYHORSPHQWSURMHFW %DVHG RQ D -XO\ UHYLHZ RI WKH 86 )LVK DQG :LOGOLIH 6HUYLFH 86):6 WHFKQLFDO DVVLVWDQFH ZHEVLWH VHQVLWLYH IHGHUDOO\ WKUHDWHQHG RU HQGDQJHUHG SODQW RU DQLPDO VSHFLHV 2 KDELWDWDUHQRWORFDWHGRQRUDGMDFHQWWRWKHSURMHFWDUHDDQGWKHSURSRVHGSURMHFWZLOOKDYH³QR HIIHFW´RQWKRVHVSHFLHV VHHDWWDFKHG86):65HYLHZ6XPPDU\ )XUWKHUFRQVXOWDWLRQZLWK WKLVDJHQF\LVQRWUHTXLUHGIRUD6HFWLRQ3HUPLWIURPWKH86$&( $FFRUGLQJ WR WKH ,OOLQRLV 'HSDUWPHQW RI 1DWXUDO 5HVRXUFHV ,'15 WKH IROORZLQJ SURWHFWHG UHVRXUFHVPD\EHLQWKHYLFLQLW\RIWKHSURMHFWORFDWLRQ 0RWWOHG6FXOSLQ Cottus bairdii )XUWKHU LQIRUPDWLRQDQGDUHYLHZIURPWKH,'15LVIRUWKFRPLQJ VHHDWWDFKHGFRUUHVSRQGHQFH $WWKHWLPHRIWKLVZHWODQGGHOLQHDWLRQUHSRUWFXUUHQWUHJXODWLRQVVWDWHWKDWWKLVGHOLQHDWLRQLV YDOLGIRU\HDUVIURPWKHILHOGZRUNGDWH-XQH 352-(&7385326( 7KHSXUSRVHRIWKHVLWHYLVLWZDVWRLGHQWLI\UHJXODWHGVXUIDFHZDWHUUHVRXUFHVRQRUZLWKLQ IHHWRIWKHSURMHFWDUHD$IORRGSODLQGHWHUPLQDWLRQZDVQRWLQFOXGHGDVSDUWRIRXULQYHVWLJDWLRQ 2QVLWHZHWODQGDUHDVHQFRXQWHUHGZHUHGHOLQHDWHGXVLQJVWDQGDUGPHWKRGVVDQFWLRQHGE\WKH 8QLWHG6WDWHV$UP\&RUSVRI(QJLQHHUVLQWKH&RUSVRI(QJLQHHUV:HWODQGV'HOLQHDWLRQ0DQXDO DQG5HJLRQDO6XSSOHPHQWWRWKH&RUSVRI(QJLQHHUV:HWODQG'HOLQHDWLRQ0DQXDO 0LGZHVW 1RUWKHDVW 5HJLRQ DQG WKH 8QLWHG 6WDWHV 'HSDUWPHQW RI $JULFXOWXUH 1DWLRQDO )RRG 6HFXULW\$FW0DQXDO DQG 3ODQWREVHUYDWLRQVZHUHPDGHLQRUGHUWRFDOFXODWHWKH &RHIILFLHQW RI &RQVHUYDWLVP ƙ DQG )ORULVWLF 4XDOLW\ ,QGH[ )4, IRU HDFK ZHWODQG SODQW FRPPXQLW\ XVLQJ WKH &KLFDJR 5HJLRQ )4$ &DOFXODWRU +HUPDQ %6OLZLQVNL 5 DQG 6 :KLWDNHU 3 0(7+2'6 86$&(:HWODQG'HOLQHDWLRQ0DQXDODQG0LGZHVW5HJLRQDO6XSSOHPHQW 3ULRUWRWKHVLWHYLVLWDSUHOLPLQDU\VLWHHYDOXDWLRQLVSHUIRUPHGXVLQJDHULDOSKRWRJUDSK\DQG QDWXUDOUHVRXUFHPDSSLQJ3RWHQWLDOZHWODQGDUHDVLGHQWLILHGE\WKHVHUHVRXUFHVDUHHYDOXDWHG LQ WKHILHOG WR GHWHUPLQH LIWKH\ PHHWWKHUHTXLUHPHQWVIRU D ZHWODQGEDVHG RQWKH 86$&( SDUDPHWHUVRIYHJHWDWLRQK\GURORJ\DQGVRLOV,QJHQHUDOSRVLWLYHLQGLFDWLRQRIHDFKRIWKH WKUHH SDUDPHWHUV PXVW EH GHPRQVWUDWHG WR FODVVLI\ DQ DUHD DV ZHWODQG (DFK RI WKHVH SDUDPHWHUVLVGLVFXVVHGEHORZ x9HJHWDWLRQ±7KUHHYHJHWDWLYHLQGLFDWRUVDUHDSSOLHGWRSODQWFRPPXQLWLHVLQRUGHUWR GHWHUPLQHLIWKHK\GURSK\WLFYHJHWDWLRQFULWHULRQLVPHW 0RUHWKDQRIWKHGRPLQDQWSODQWVSHFLHVDFURVVDOOVWUDWDPXVWEHK\GURSK\WLF ZDWHUWROHUDQW 7KH86$UP\&RUSVRI(QJLQHHUVKDVSUHSDUHGDUHJLRQDOOLVWRI SODQWV RFFXUULQJ LQ ZHWODQGV ZKLFK DVVLJQV WKH SODQW VSHFLHV GLIIHUHQW LQGLFDWRUV :HWODQGSODQWVIDOOLQWRWKUHHLQGLFDWRUFODVVHVEDVHGRQGLIIHULQJWROHUDQFHVWRZDWHU OHYHO DQG VRLO VDWXUDWLRQ 7KHVH LQGLFDWRUV DUH UDWHG REOLJDWH ZHWODQG 2%/ IDFXOWDWLYH ZHWODQG )$&: RU IDFXOWDWLYH )$& 'RPLQDQW SODQW VSHFLHV DUH UHFRUGHGDWVDPSOHSRLQWVZLWKLQLQYHVWLJDWHGDUHDV 7KHSUHYDOHQFHLQGH[LVRUOHVV7KHSUHYDOHQFHLQGH[LVDZHLJKWHGDYHUDJH ZHWODQGLQGLFDWRUVWDWXVRIDOOSODQWVSHFLHVLQDVDPSOLQJSORW(DFKLQGLFDWRUVWDWXV FDWHJRU\LVJLYHQDQXPHULFYDOXH 2%/ )$&: )$& )$&8 DQG 83/ DQGZHLJKWLQJLVE\DEXQGDQFH$SUHYDOHQFHLQGH[RIRUOHVVLQGLFDWHV WKDWK\GURSK\WLFYHJHWDWLRQLVSUHVHQW7KHSUHYDOHQFHLQGH[LVXVHGWRGHWHUPLQH ZKHWKHUK\GURSK\WLFYHJHWDWLRQLVSUHVHQWRQVLWHVZKHUHLQGLFDWRUVRIK\GULFVRLODQG ZHWODQGK\GURORJ\DUHSUHVHQWEXWWKHYHJHWDWLRQLQLWLDOO\IDLOVWKHGRPLQDQFHWHVW 7KHSODQWFRPPXQLW\SDVVHVHLWKHUWKHGRPLQDQFHWHVW ,QGLFWRU RUWKHSUHYDOHQFH LQGH[ ,QGLFDWRU DIWHU UHFRQVLGHUDWLRQ RI WKH LQGLFDWRU VWDWXV RI FHUWDLQ SODQW VSHFLHV WKDW H[KLELW PRUSKRORJLFDO DGDSWDWLRQV IRU OLIH LQ ZHWODQGV &RPPRQ PRUSKRORJLFDO DGDSWDWLRQV LQFOXGH EXW DUH QRW OLPLWHG WR DGYHQWLWLRXV URRWV PXOWL VWHPPHGWUXQNVVKDOORZURRWV\VWHPVGHYHORSHGRQRUQHDUWKHVRLOVXUIDFHDQG EXWWUHVVLQJLQWUHHVSHFLHV7RDSSO\WKLVLQGLFDWRUWKHVHPRUSKRORJLFDOIHDWXUHV PXVWEHREVHUYHGRQPRUHWKDQRIWKHLQGLYLGXDOVRID)$&8VSHFLHVOLYLQJLQ DQDUHDZKHUHLQGLFDWRUVRIK\GULFVRLODQGZHWODQGK\GURORJ\DUHSUHVHQW x+\GURORJ\±7REHFRQVLGHUHGDZHWODQGDQDUHDPXVWKDYHRUPRUHFRQVHFXWLYH GD\VRIIORRGLQJRUSRQGLQJRUDZDWHUWDEOHLQFKHVRUOHVVEHORZWKHVRLOVXUIDFH GXULQJWKHJURZLQJVHDVRQDWDPLQLPXPIUHTXHQF\RI\HDUVLQ:HWODQGK\GURORJ\ LQGLFDWRUVDUHGLYLGHGLQWRIRXUJURXSVDVGHVFULEHGEHORZ o*URXS$±LQGLFDWRUVDUHEDVHGRQWKHGLUHFWREVHUYDWLRQRIVXUIDFHZDWHURU JURXQGZDWHUGXULQJDVLWHYLVLW o*URXS%±FRQVLVWVRIHYLGHQFHWKDWWKHVLWHLVVXEMHFWWRIORRGLQJRUSRQGLQJ DOWKRXJK LW PD\ QRW EH LQXQGDWHG FXUUHQWO\ 7KHVH LQGLFDWRUV LQFOXGH ZDWHU PDUNVGULIWGHSRVLWVVHGLPHQWGHSRVLWVDQGVLPLODUIHDWXUHV o*URXS&±FRQVLVWVRIRWKHUHYLGHQFHWKDWWKHVRLOLVVDWXUDWHGFXUUHQWO\RUZDV VDWXUDWHG UHFHQWO\ 6RPH RI WKHVH LQGLFDWRUV VXFK DV R[LGL]HG UKL]RSKHUHV VXUURXQGLQJOLYLQJURRWVDQGWKHSUHVHQFHRIUHGXFHGLURQRUVXOIXULQWKHVRLO SURILOHLQGLFDWHWKDWWKHVRLOKDVEHHQVDWXUDWHGIRUDQH[WHQGHGSHULRG 4 o*URXS '± FRQVLVWV RI ODQGVFDSH DQG YHJHWDWLRQ FKDUDFWHULVWLFV WKDW LQGLFDWH FRQWHPSRUDU\ UDWKHU WKDQ KLVWRULFDO ZHW FRQGLWLRQV 7KHVH LQGLFDWRUV LQFOXGH VWXQWHGRUVWUHVVHGSODQWVJHRPRUSKLFSRVLWLRQDQGWKH)$&QHXWUDOWHVW :HWODQGK\GURORJ\LQGLFDWRUVDUHLQWHQGHGDVRQHWLPHREVHUYDWLRQVRIVLWHFRQGLWLRQV WKDW DUH VXIILFLHQW HYLGHQFH RI ZHWODQG K\GURORJ\ :LWKLQ HDFK JURXS LQGLFDWRUV DUH GLYLGHGLQWRWZRFDWHJRULHV±primaryDQGsecondary2QHSULPDU\LQGLFDWRUIURPDQ\ JURXSLVVXIILFLHQWWRFRQFOXGHWKDWZHWODQGK\GURORJ\LVSUHVHQW,QWKHDEVHQFHRID SULPDU\ LQGLFDWRU WZR RU PRUH VHFRQGDU\ LQGLFDWRUV IURP DQ\ JURXS DUH UHTXLUHG WR FRQFOXGHWKDWZHWODQGK\GURORJ\LVSUHVHQW x6RLOV7REHFRQVLGHUHGDZHWODQGDQDUHDPXVWFRQWDLQK\GULFVRLO+\GULFVRLOVDUH IRUPHG XQGHU FRQGLWLRQV RI VDWXUDWLRQ IORRGLQJ RU SRQGLQJ ORQJ HQRXJK GXULQJ WKH JURZLQJ VHDVRQ WR GHYHORS DQDHURELF ODFNLQJ R[\JHQ FRQGLWLRQV LQ WKH XSSHU SDUW 6RLOVJHQHUDOO\EXWQRWDOZD\VZLOOGHYHORSLQGLFDWRUVWKDWDUHIRUPHGSUHGRPLQDQWO\E\ WKHDFFXPXODWLRQRUORVVRILURQPDQJDQHVHVXOIXURUFDUERQFRPSRXQGVLQDVDWXUDWHG DQGDQDHURELFHQYLURQPHQW7KHPRVWFXUUHQWHGLWLRQRIWKH8QLWHG6WDWHV'HSDUWPHQW RI$JULFXOWXUH1DWXUDO5HVRXUFH&RQVHUYDWLRQ6HUYLFH Field Indicators of Hydric Soils in the United StatesLVXVHGIRULGHQWLILFDWLRQRIK\GULFVRLOV)LHOGLQGLFDWRUVRIK\GULFVRLOV LQFOXGH EXW DUH QRW OLPLWHG WR WKH SUHVHQFH RI DQ\ RI WKH IROORZLQJ KLVWLF HSLSHGRQ VXOILGLF RGRU DW OHDVW FHQWLPHWHUV RI PXFN GHSOHWHG PDWUL[ DQGRU UHGR[LPRUSKLF IHDWXUHV)LHOGLQGLFDWRUVDUHXVXDOO\H[DPLQHGLQWKHWRSLQFKHVRIWKHVRLO6RLO FRORUVDUHGHWHUPLQHGXVLQJMunsell Soil Color Charts $UHDVPHHWLQJWKHVHWKUHHFULWHULDDUHVWDNHGLQWKHILHOGIRUVXUYH\LQJSXUSRVHV%RXQGDULHV DUHGHPDUFDWHGLQWKHILHOGZLWKSLQNIODJJHGSLQVWDNHVODEHOHG³:(7/$1''(/,1($7,21´ 6WDNHGERXQGDULHVDUHPDSSHGRQDQDHULDOSKRWRJUDSKLQFOXGHGLQWKLVUHSRUW$SSUR[LPDWH RIIVLWHZHWODQGERXQGDULHVDUHLGHQWLILHGRQWKHDHULDOSKRWRJUDSKDQGZHUHGHWHUPLQHGXVLQJ DYDLODEOHDHULDOSKRWRJUDSKVZHWODQGPDSVDQGILHOGREVHUYDWLRQ )DUPHG:HWODQG'HWHUPLQDWLRQV (1&$3,QFFRQGXFWHGDZHWODQGGHWHUPLQDWLRQRQWKHIDUPHGSRUWLRQRIWKHSURMHFWDUHDXVLQJ 1DWLRQDO)RRG6HFXULW\$FW0DQXDO 1)6$0 PHWKRGRORJ\$HULDOSKRWRJUDSKVDUHUHYLHZHGLQ RUGHUWRLGHQWLI\SRWHQWLDOIDUPHGZHWODQGVLJQDWXUHV7KHLGHQWLILHGVXVSHFWDUHDVDUHWKHQILHOG LQYHVWLJDWHGWRFRQILUPWKDWWKHDUHDVDUHLQIDFWZHWODQGV&RSLHVRIWKHDHULDOSKRWRJUDSKV XVHGLQLGHQWLI\LQJIDUPHGZHWODQGVDUHLQFOXGHGLQWKLVUHSRUW 5 0$35(9,(: x7KH1DWLRQDO :HWODQGV ,QYHQWRU\GRHV QRW LGHQWLI\ DQ\ ZDWHU UHVRXUFHV RU ZHWODQGVZLWKLQWKHSURMHFWDUHD ([KLELW% x 7KH6RLO0DSLGHQWLILHVWKHIROORZLQJVRLOVZLWKLQWKHSURMHFWDUHD &DPGHQVLOWORDP WRSHUFHQWVORSHVHURGHG & %UHQWRQVLOWORDPWRSHUFHQWVORSHV $ 0LOOEURRNVLOWORDPWRSHUFHQWVORSHV $ 3HRWRQHVLOW\FOD\ORDPWR SHUFHQWVORSHV $ DQG6RPRQDXNVLOWORDPWRSHUFHQWVORSHV % 3HRWRQHVLOW\FOD\ORDPLVFRQVLGHUHGK\GULFLQ.HQGDOO&RXQW\ ([KLELW& x7KH8QLWHG6WDWHV*HRORJLFDO6XUYH\ 86*6 7RSRJUDSKLF0DSGRHVQRW LGHQWLI\DQ\VXUIDFHGUDLQDJHZLWKLQWKHVLWH KRZHYHU5RE5R\&UHHNLVLGHQWLILHG HDVWRIWKHVLWH ([KLELW' x 7KH)(0$)ORRG,QVXUDQFH5DWH0DSLGHQWLILHVWKHSURMHFWDUHDRXWVLGHWKH \HDUIORRGSODLQ ([KLELW( x7KH,OOLQRLV 6WDWH +LVWRULF 3UHVHUYDWLRQ 2IILFH ,6+32 +LVWRULF $UFKLWHFWXUDO 5HVRXUFHV*HRJUDSKLF,QIRUPDWLRQ6\VWHP +$5*,6 0DSGRHVQRWLGHQWLI\DQ\ SURSHUWLHVRUREMHFWVWKDWKDYHEHHQOLVWHGLQWKH1DWLRQDO5HJLVWHURI+LVWRULF3ODFHV GHWHUPLQHGHOLJLEOHRUVXUYH\HGZLWKRXWGHWHUPLQDWLRQZLWKLQWKHSURMHFWDUHD ([KLELW ) 6 63(&,),&'(6&5,37,212),'(17,),(':$7(55(6285&(6 )DUPHG:HWODQG7KLVZHWODQG DFUHVLQWRWDOVL]H LVORFDWHGZLWKLQWKHZHVWHUQSRUWLRQ RIWKHSURMHFWDUHD)DUPHG:HWODQGH[KLELWHGZHWODQGVLJQDWXUHVLQRXWRIKLVWRULFDHULDO SKRWRJUDSKVIURP\HDUVZLWKQRUPDOSUHFLSLWDWLRQ7KHORFDWLRQDQGDFUHDJHRI)DUPHG:HWODQG ZHUHGHWHUPLQHGWKURXJKDHULDOSKRWRJUDSKLQWHUSUHWDWLRQDQGLWVERXQGDULHVZHUHQRWILHOG VWDNHGE\(1&$3,QF%DVHGRQWKHGHILQLWLRQRIDKLJKTXDOLW\DTXDWLFUHVRXUFH)DUPHG :HWODQGZRXOGQRWEHFRQVLGHUHGDKLJKTXDOLW\DTXDWLFUHVRXUFH7KHUHZHUHQRZDWHUIRZORU DPSKLELDQVSHFLHVREVHUYHGXWLOL]LQJ)DUPHG:HWODQGZKLOHDWWKHSURMHFWDUHD 7KHEXIIHUVXUURXQGLQJ)DUPHG:HWODQGFRQVLVWVHQWLUHO\RIDJULFXOWXUDOILHOGV7KHVHEXIIHUV GRQRWSURYLGHEHQHILFLDOIXQFWLRQVIRUWKHIDUPHGZHWODQG )DUPHG:HWODQGDSSHDUVWREHLVRODWHGDQGWKHUHIRUHQRWXQGHUWKHMXULVGLFWLRQRIWKH86 $UP\&RUSVRI(QJLQHHUV)DUPHG:HWODQGZLOOEHUHJXODWHGE\.HQGDOO&RXQW\XQGHUWKH .HQGDOO&RXQW\6WRUPZDWHU0DQDJHPHQW2UGLQDQFH 2QHVDPSOH SRLQW ZDVHVWDEOLVKHG ZLWKLQ )DUPHG :HWODQG WR FKDUDFWHUL]HWKHYHJHWDWLRQ VRLOVDQGK\GURORJ\ ([KLELW* $HULDO3KRWRJUDSK )DUPHG:HWODQGZDVSULPDULO\YHJHWDWHG E\SODQWHG&RUQEXWZDVODUJHO\XQYHJHWDWHGGXULQJWKHVLWHYLVLW.7KHPDSSHGVRLOVHULHVLV 3HRWRQHVLOW\FOD\ORDPWRSHUFHQWVORSHV $ DK\GULFVRLO86'$ILHOGLQGLFDWRU$ 7KLFN'DUN6XUIDFHSURYLGHGHYLGHQFHRIK\GULFVRLO6DWXUDWLRQLQXQGDWLRQYLVLEOHRQDHULDO LPDJHU\VSDUVHO\YHJHWDWHGFRQFDYHVXUIDFHVDWXUDWLRQYLVLEOHRQDHULDOLPDJHU\VWXQWHGRU VWUHVVHG SODQWV JHRPRUSKLF SRVLWLRQ DQG KLVWRULF DHULDO SKRWRJUDSK LQWHUSUHWDWLRQ SURYLGHG HYLGHQFHRISHUVLVWHQWK\GURORJ\ 6HH:HWODQG'HWHUPLQDWLRQ'DWD)RUPV 7KHQDWLYHPHDQ&RHIILFLHQWRI&RQVHUYDWLVP ƙ IRU)DUPHG:HWODQGZDVDQGWKHQDWLYH )ORULVWLF4XDOLW\,QGH[ )4, RI)DUPHG:HWODQGZDV VHHDWWDFKHG)ORULVWLF4XDOLW\'DWD 7KHVHYDOXHVLQGLFDWHDORZTXDOLW\SODQWFRPPXQLW\ )DUPHG:HWODQG7KLVZHWODQG DFUHVLQWRWDOVL]H LVORFDWHGZLWKLQWKHQRUWKHUQSRUWLRQ RIWKHSURMHFWDUHD)DUPHG:HWODQGH[KLELWHGZHWODQGVLJQDWXUHVLQRXWRIKLVWRULFDHULDO SKRWRJUDSKVIURP\HDUVZLWKQRUPDOSUHFLSLWDWLRQ7KHORFDWLRQDQGDFUHDJHRI)DUPHG:HWODQG ZHUHGHWHUPLQHGWKURXJKDHULDOSKRWRJUDSKLQWHUSUHWDWLRQDQGLWVERXQGDULHVZHUHQRWILHOG VWDNHG E\ (1&$3 ,QF %DVHG RQ WKH GHILQLWLRQ RI D KLJKTXDOLW\ DTXDWLF UHVRXUFH )DUPHG :HWODQGZRXOGQRWEHFRQVLGHUHGDKLJKTXDOLW\DTXDWLFUHVRXUFH7KHUHZHUHQRZDWHUIRZORU DPSKLELDQVSHFLHVREVHUYHGXWLOL]LQJ)DUPHG:HWODQGZKLOHDWWKHSURMHFWDUHD 7KHEXIIHUVXUURXQGLQJ)DUPHG:HWODQGFRQVLVWVHQWLUHO\RIDJULFXOWXUDOILHOGV7KHVHEXIIHUV GRQRWSURYLGHEHQHILFLDOIXQFWLRQVIRUWKHIDUPHGZHWODQG )DUPHG:HWODQGDSSHDUVWREHLVRODWHGDQGWKHUHIRUHQRWXQGHUWKHMXULVGLFWLRQRIWKH86 $UP\&RUSVRI(QJLQHHUV)DUPHG:HWODQGZLOOEHUHJXODWHGE\.HQGDOO&RXQW\XQGHUWKH .HQGDOO&RXQW\6WRUPZDWHU0DQDJHPHQW2UGLQDQFH 2QHVDPSOHSRLQWZDVHVWDEOLVKHGZLWKLQDQGDGMDFHQWWR)DUPHG:HWODQGWRFKDUDFWHUL]HWKH YHJHWDWLRQVRLOVDQGK\GURORJ\ ([KLELW* $HULDO3KRWRJUDSK )DUPHG:HWODQGZDVSULPDULO\ YHJHWDWHGE\SODQWHG&RUQEXWZDVODUJHO\XQYHJHWDWHGGXULQJWKHVLWHYLVLW7KHPDSSHGVRLO VHULHV LV 3HRWRQH VLOW\ FOD\ ORDP WR SHUFHQW VORSHV $ D K\GULFVRLO86'$ILHOG LQGLFDWRU$ 7KLFNGDUNVXUIDFHSURYLGHGHYLGHQFHRIK\GULFVRLO,QXQGDWLRQYLVLEOHRQDHULDO LPDJHU\VSDUVHO\YHJHWDWHGFRQFDYHVXUIDFHVXUIDFHVRLOFUDFNVVDWXUDWLRQYLVLEOHRQDHULDO 7 LPDJHU\ VWXQWHG RU VWUHVVHG SODQWV JHRPRUSKLF SRVLWLRQ DQG D UHYLHZ RI KLVWRULF DHULDO SKRWRJUDSKV SURYLGHG HYLGHQFH RI SHUVLVWHQW K\GURORJ\ 6HH :HWODQG 'HWHUPLQDWLRQ 'DWD )RUPV 7KHQDWLYHPHDQ&RHIILFLHQWRI&RQVHUYDWLVP ƙ IRU)DUPHG:HWODQGZDVDQGWKHQDWLYH )ORULVWLF4XDOLW\,QGH[ )4, RI)DUPHG:HWODQGZDV VHHDWWDFKHG)ORULVWLF4XDOLW\'DWD 7KHVHYDOXHVLQGLFDWHDORZTXDOLW\SODQWFRPPXQLW\ 2II6LWH:HWODQG7KLVZHWODQGLVORFDWHGRIIVLWHMXVWHDVWWKHHDVWHUQERUGHURIWKHSURMHFW DUHD 7KH ZHWODQG LV DVVRFLDWHG ZLWK 5RE 5R\ &UHHN D WULEXWDU\WRWKH)R[5LYHU2IIVLWH :HWODQGDQGLWVVXUURXQGLQJFRUULGRULVGRPLQDWHGE\IDVWJURZLQJWUHHVDQGGHQVHLQYDVLYH VKUXEVZLWKLQWHUPLWWHQWKHUEDFHRXVYHJHWDWLRQ7KHFUHHNLWVHOILVDSSUR[LPDWHO\¶LQZLGWK ZLWK¶KLJKEDQNVDQGDSSUR[LPDWHO\¶RIZDWHUGHSWKLQWKHFKDQQHO1RZDWHUIRZORU DPSKLELDQVSHFLHVZHUHREVHUYHGXWLOL]LQJ2IIVLWH:HWODQGZKLOHDWWKHSURMHFWDUHD KRZHYHU :KLWH7DLO'HHUZHUHREVHUYHGRQVLWH 7KH EXIIHU VXUURXQGLQJ 2II6LWH :HWODQG FRQVLVWV RI DJULFXOWXUDO ODQGVDQG VFUXEVKUXE YHJHWDWLRQ7KHVHEXIIHUVSURYLGHPLQLPDOEHQHILFLDOIXQFWLRQVIRUWKHZHWODQGLQFOXGLQJPLQLPDO ZLOGOLIHKDELWDWRYHUODQGIORZILOWUDWLRQDQGLQILOWUDWLRQ 'XHWRWKHGLUHFWK\GURORJLFDOFRQQHFWLRQWR5RE5R\&UHHNDQGVXEVHTXHQWO\WKH)R[5LYHULW PD\EHDVVXPHGWKDW2IIVLWH:HWODQGLVMXULVGLFWLRQDOE\WKH86$&(%DVHGRQWKHGHILQLWLRQ RIDKLJKTXDOLW\DTXDWLFUHVRXUFH2II6LWH:HWODQGZRXOGQRWEHFRQVLGHUHGDKLJKTXDOLW\ DTXDWLFUHVRXUFH 2II6LWH:HWODQGZDVSULPDULO\YHJHWDWHGE\%R[(OGHU Acer negundo DQG5HHG&DQDU\ *UDVV Phalaris arundinacea 7KHPDSSHGVRLOVHULHVLV3HRWRQHVLOW\FOD\ORDPWRSHUFHQW DK\GULFVRLO7KHQDWLYHPHDQ&RHIILFLHQWRI&RQVHUYDWLVP ƙ IRU2II6LWH:HWODQGZDV DQG WKH QDWLYH )ORULVWLF 4XDOLW\ ,QGH[ )4, RI 2II6LWH :HWODQG ZDV VHH DWWDFKHG )ORULVWLF4XDOLW\'DWD 7KHVHYDOXHVLQGLFDWHDORZTXDOLW\SODQWFRPPXQLW\ 8 ,19(67,*$7,212))$50('$5($6 'XULQJWKHILHOGLQYHVWLJDWLRQWKHPDMRULW\RIWKHVLWHFRQVLVWHGRIDJULFXOWXUDOODQG(1&$3,QF HYDOXDWHG)DUP6HUYLFH$JHQF\ )6$ DHULDOSKRWRJUDSKV VOLGHV REWDLQHGIURP*RRJOH(DUWK \HDUE\\HDU XVLQJ 15&6 ZHWODQG VLJQDWXUH FULWHULD :HWODQG VLJQDWXUHV FRQVLVW RI ZHWODQG YHJHWDWLRQ VXUIDFH ZDWHU GURZQHGRXW FURSV SDWFKHV RI JUHHQHU YHJHWDWLRQ DQG DYRLGHG DUHDV$UHDVH[KLELWLQJZHWODQGVLJQDWXUHVLQ!RUPRUHRIUHYLHZHGDHULDOSKRWRJUDSKVDQG FRQWDLQLQJ K\GULF VRLO DUH FRQVLGHUHG IDUPHG ZHWODQGV $GGLWLRQDOO\ LI DUHDV GR QRW H[KLELW ZHWODQG VLJQDWXUHV LQ ! RU PRUH RI UHYLHZHG DHULDO SKRWRJUDSKV EXW GR H[KLELW SRVLWLYH SULPDU\RUVHFRQGDU\ZHWODQGK\GURORJ\LQGLFDWRUVLQWKHILHOGZLWKK\GULFVRLOVWKH\DUHDOVR FRQVLGHUHG IDUPHG ZHWODQGV 6HH WKH DWWDFKHG DHULDO SKRWRJUDSKV IRU \HDUV UHYLHZHG DQG ZHWODQG VLJQDWXUHV REVHUYHG )LJXUHV DQG WDEOHV IURP WKH 86$UP\ &RUSV RI (QJLQHHUV $QWHFHGHQW3UHFLSLWDWLRQ7RROZKLFKLQGLFDWHWKHK\GURORJLFFRQGLWLRQVIRUHDFKKLVWRULFDHULDO LPDJHDUHDOVRDWWDFKHG 7DEOH6OLGH$QDO\VLV6XPPDU\ *UHHQEHUJ)DUURZ%HHFKHU5RDG <HDU *RRJOH(DUWK 6RXUFH 3UHFLSLWDWLRQ 6DPSOH3RLQWV 7\SHRI6LJQDWXUH&RUUHVSRQGLQJ1XPEHU $ % *RRJOH(DUWK 1RUPDO &7 1 *RRJOH(DUWK 1RUPDO &7 &7 *RRJOH(DUWK 1RUPDO &7 &7 *RRJOH(DUWK 1RUPDO &7 &7 *RRJOH(DUWK 1RUPDO &7 &7 2013 Google Earth WET CT / 1 CT / 2 3HUFHQWZHWODQGVLJQDWXUHVSUHVHQWLQ \HDUVZLWKQRUPDOSUHFLSLWDWLRQ +\GULFVRLOSUHVHQWEDVHGRQILHOG LQVSHFWLRQ <HV <HV ,GHQWLILHGDVZHWODQGRQWKH1:, 1R 1R 4XDOLILHVDV)DUPHG:HWODQG <HV <HV ,18 ,QXQGDWLRQ &7 &RORU7RQH'LIIHUHQFH 6$7 6DWXUDWLRQ 1 1R:HWODQG6LJQDWXUHV2EVHUYHG < <HV,GHQWLILHG 9 5(*8/$725<67$7(0(17 )HGHUDO 5HJXODWLRQV 7KH GHSRVLWLRQ RI GUHGJHG RU ILOO PDWHULDOV LQWR IHGHUDOO\ MXULVGLFWLRQDO ZHWODQGVRU:DWHUVRIWKH8QLWHG6WDWHVLVUHJXODWHGE\WKH86$&(XQGHU6HFWLRQRIWKH &OHDQ:DWHU$FW 7KH 1DWLRQZLGH 3HUPLW DXWKRUL]HV DFUH RU OHVV RI ORZ TXDOLW\ ZHWODQGV WREH ILOOHG ZLWKRXWPLWLJDWLRQ,IRYHUDFUHLVSURSRVHGIRUILOOLQJRULVVXEMHFWWRVHFRQGDU\LPSDFWVLQ NLQGPLWLJDWLRQPD\EHUHTXLUHGDWDUDWLRRI RUJUHDWHU7KHDJJUHJDWHWRWDOORVVRIZDWHUV RIWKH86DXWKRUL]HGE\1:3 FDQQRWH[FHHGDFUHRUOLQHDUIHHWRIVWUHDPEHG 8QGHUWKHH[LVWLQJUHJXODWLRQVVHFRQGDU\LPSDFWV ERWKRQVLWHDQGRIIVLWH IURPILOOLQJDOVR PXVWEHHYDOXDWHG0LWLJDWLRQPD\EHUHTXLUHGDWDKLJKHUUDWHLIDSURMHFWZLOOVLJQLILFDQWO\DOWHU ZHWODQG IXQFWLRQV VXFK DV VWRUPZDWHU GHWHQWLRQ ZDWHU ILOWUDWLRQ VHGLPHQW WUDSSLQJ DQGRU ZLOGOLIHKDELWDW %HIRUHPLWLJDWLRQZLOOEHDSSURYHGUHDVRQDEOHSURRIWKDWDYRLGDQFHRUPLQLPL]DWLRQRIZHWODQG LPSDFWVKDVEHHQDWWHPSWHGPXVWEHSURYLGHGWRWKH&RUSV $ 86$&( SHUPLW LV QRW UHTXLUHG LI WKH ZHWODQGV DUH DYRLGHG DQGFRQVWUXFWLRQ HURVLRQ QHDU ZHWODQGVLVFRQWUROOHG .HQGDOO &RXQW\ 6WRUPZDWHU 0DQDJHPHQW 2UGLQDQFH 2Q 'HFHPEHU .HQGDOO &RXQW\DGRSWHGD6WRUPZDWHU0DQDJHPHQW2UGLQDQFHZLWKDPRVWUHFHQWXSGDWHRI0D\ 7KHRUGLQDQFHSURYLGHVIRUWKHSURWHFWLRQRIZHWODQGVDQGRWKHUGHSUHVVLRQDOVWRUDJH DUHDV IURP GDPDJLQJ PRGLILFDWLRQV DQG DGYHUVH FKDQJHV LQ UXQRII TXDOLW\ DQG TXDQWLW\ DVVRFLDWHGZLWKODQGGHYHORSPHQWV 1DWXUDO YHJHWDWLRQ VKDOO EH UHWDLQHG DQG SURWHFWHG $UHDV LPPHGLDWHO\ DGMDFHQW WR QDWXUDO ZDWHUFRXUVHVODNHVSRQGVDQGZHWODQGVVKDOOEHOHIWXQGLVWXUEHGGXULQJGHYHORSPHQWWRWKH JUHDWHVWH[WHQWSRVVLEOH7HPSRUDU\FURVVLQJVRIZDWHUFRXUVHVZKHQSHUPLWWHGPXVWLQFOXGH DSSURSULDWHZDWHUFRXUVHDQGEDQNVWDELOL]DWLRQPHDVXUHV 6SHFLDO SUHFDXWLRQV VKDOO EH WDNHQ WR SUHYHQW GDPDJHV UHVXOWLQJ IURP DQ\ QHFHVVDU\ GHYHORSPHQW DFWLYLW\ ZLWKLQ RU DGMDFHQW WR DQ\ VWUHDP ODNH SRQG RU ZHWODQG 3UHYHQWDWLYH PHDVXUHVVKDOOUHIOHFWWKHVHQVLWLYLW\RIWKHVHDUHDVWRHURVLRQDQGVHGLPHQWDWLRQ ,OOLQRLV'HSDUWPHQWRI1DWXUDO5HVRXUFHV$JHQF\$FWLRQ3ODQVIRU,QWHUDJHQF\:HWODQGV 3ROLF\$FWRI 7KH,OOLQRLV,QWHUDJHQF\:HWODQGV3ROLF\$FWRI LVLQWHQGHGWRHQVXUH WKDWWKHUHLVQRRYHUDOOQHWORVVRIWKH6WDWH¶VH[LVWLQJZHWODQGDFUHVRUWKHLUIXQFWLRQDOYDOXHV UHVXOWLQJIURP6WDWHVXSSRUWHGDFWLYLWLHV7KH$FWFKDUJHV6WDWHDJHQFLHVZLWKDIXUWKHUGXW\WR ³SUHVHUYHHQKDQFHDQGFUHDWHZHWODQGVZKHUHQHFHVVDU\WRLQFUHDVHWKHTXDOLW\DQGTXDQWLW\RI WKH6WDWH¶VZHWODQGUHVRXUFHEDVH´ 7KH,QWHUDJHQF\:HWODQGV3ROLF\$FWRI VWDWHVWKDWDQ\FRQVWUXFWLRQODQGPDQDJHPHQWRU RWKHUDFWLYLW\SHUIRUPHGE\RUIRUZKLFKILQDQFLDODVVLVWDQFHLVDGPLQLVWHUHGRUSURYLGHGE\D 6WDWHDJHQF\WKDWZLOOUHVXOWLQDQDGYHUVHLPSDFWWRDZHWODQGVKDOOEHVXEMHFWWRFRPSOLDQFH 7KLVLQFOXGHVEXWLVQRWOLPLWHGWRWKHIROORZLQJ 10 7KHDOWHUDWLRQUHPRYDOH[FDYDWLRQRUGUHGJLQJRIVRLOVDQGJUDYHOPLQHUDOVRUJDQLF PDWWHUYHJHWDWLRQRUQDWXUDOO\RFFXUULQJPLQHUDOVRIDQ\NLQGIURPDZHWODQG 7KHGLVFKDUJHRUGHSRVLWRIILOOPDWHULDORUGUHGJHGPDWHULDOLQDZHWODQG 7KH DOWHUDWLRQ RI H[LVWLQJ GUDLQDJH FKDUDFWHULVWLFV VHGLPHQWDWLRQ SDWWHUQV RU IORRG UHWHQWLRQFKDUDFWHULVWLFVRIDZHWODQG 7KHGLVWXUEDQFHRIZDWHUOHYHORUZDWHUWDEOHRIDZHWODQG 7KH GHVWUXFWLRQ RU UHPRYDO RI SODQW OLIH WKDW ZRXOG DOWHU WKHFKDUDFWHU RI D ZHWODQG H[FHSWIRUDFWLYLWLHVXQGHUWDNHQLQDFFRUGDQFHZLWKWKH,OOLQRLV1R[LRXV:HHG$FW 7KHWUDQVIHURI6WDWHRZQHGZHWODQGVWRDQ\HQWLW\RWKHUWKDQDQRWKHUVWDWHDJHQF\ DQG 2WKHUDFWLRQVWKDWFDXVHRUPD\FDXVHDGYHUVHZHWODQGLPSDFWV 7KH$FWLVWREHLPSOHPHQWHGWKURXJKD6WDWH:HWODQG0LWLJDWLRQ3ROLF\7KH6WDWH:HWODQG 0LWLJDWLRQ3ROLF\UHTXLUHVSUHVHUYDWLRQRIZHWODQGVDVWKHSULPDU\REMHFWLYH:KHUHDGYHUVH ZHWODQGLPSDFWVDUHXQDYRLGDEOHSURJUHVVLYHOHYHOVRIFRPSHQVDWLRQEDVHGXSRQWKHOHYHORI LPSDFWWRWKHH[LVWLQJZHWODQGDQGWKHORFDWLRQRIFRPSHQVDWLRQZHWODQGVDUHUHTXLUHG $UFKDHRORJLFDO6XUYH\5HTXLUHPHQWV $QDUFKDHRORJLFDOVXUYH\PD\EHUHTXLUHGEHIRUHD 6HFWLRQSHUPLWZLOOEHLVVXHGIRUZHWODQGLPSDFWV7KH86$UP\&RUSVRI(QJLQHHUVZLOO PDNHWKLVGHWHUPLQDWLRQDVSDUWRIWKHSHUPLWDSSOLFDWLRQUHYLHZ7KHDUFKDHRORJLFDOVXUYH\ PXVWFRYHUDOODUHDVRIWKHSURMHFWDUHDQRWZHWODQGVRQO\,I\RXDOUHDG\KDYHDOHWWHUIURPWKH ,OOLQRLV6WDWH+LVWRULF3UHVHUYDWLRQ2IILFH ,6+32 VWDWLQJDQDUFKDHRORJLFDOVXUYH\LVUHTXLUHG \RXVKRXOGDFWRQLWEHFDXVHWKH86$&(ZLOOVXSSRUWWKLVQRWLILFDWLRQ 11 5(&200(1'$7,216 7ZRIDUPHGZHWODQGVWRWDOLQJDFUHVZHUHLGHQWLILHGRQWKHSURMHFWDUHD7KHERXQGDULHVRI )DUPHG:HWODQGVDQGZHUHQRWILHOGVWDNHGE\(1&$3,QF)DUPHGZHWODQGERXQGDULHV PXVWEHVFDOHGIURPWKHDWWDFKHG$HULDO3KRWRJUDSK ([KLELW* RQWRWKHSURSHUW\ERXQGDU\ VXUYH\ 7KH86$UP\&RUSVRI(QJLQHHUVKDVWKHILQDODXWKRULW\LQGHWHUPLQLQJWKHMXULVGLFWLRQDOVWDWXV RIWKHZHWODQGVLGHQWLILHGRQVLWH KRZHYHULWLVYHU\OLNHO\WKDW)DUPHG:HWODQGVDQGZLOOEH FRQVLGHUHGQRQMXULVGLFWLRQDOLVRODWHG(1&$3,QFUHFRPPHQGVWKDWDFRS\RIWKLVUHSRUWDQGD UHTXHVW IRU DQ DSSURYHG MXULVGLFWLRQDO GHWHUPLQDWLRQ DUH VHQW WR WKH 86 $UP\ &RUSV RI (QJLQHHUV5RFN,VODQG'LVWULFW$Q$SSURYHG-XULVGLFWLRQDO'HWHUPLQDWLRQPD\WDNHEHWZHHQ PRQWKVWRUHFHLYHIURPWKH86$&(RIILFHV ,IZHWODQGVFDQEHFRPSOHWHO\DYRLGHGE\SURMHFWGHYHORSPHQWD/HWWHURI1R2EMHFWLRQ /212 1R3HUPLW5HTXLUHGPD\EHREWDLQHGIURPWKH86$&(LQOLHXRIDQ$SSURYHG-XULVGLFWLRQDO 'HWHUPLQDWLRQ$/2121R3HUPLW5HTXLUHGOHWWHUPD\WDNHEHWZHHQPRQWKVWRUHFHLYH IURPWKH86$&(RIILFHV $Q\LPSDFWVWR)DUPHG:HWODQG)DUPHG:HWODQGRU2II6LWH:HWODQGZLOOUHTXLUH86 $UP\&RUSVRI(QJLQHHUVDQGRU.HQGDOO&RXQW\QRWLILFDWLRQDQGDSSURYDO(1&$3,QFFDQ DVVLVW\RXZLWKWKHUHTXHVWIRUMXULVGLFWLRQDOGHWHUPLQDWLRQ/2121R3HUPLW5HTXLUHGSHUPLW DSSOLFDWLRQVDJHQF\QHJRWLDWLRQVZHWODQGGHVLJQSODQVDQGPLWLJDWLRQSODQVZKLFKPD\EH DSSOLFDEOHWR\RXUSURMHFW7KHZHWODQGFRQVXOWDQWVKRXOGEHLQYROYHGGXULQJWKHSODQQLQJDQG GHVLJQVWDJHVRIWKHSURMHFWWRDYRLGFRPSOLFDWLRQVZLWKWKHDJHQFLHVDIWHUWKHSODQKDVEHHQ GUDIWHG 3URSHU SODQQLQJ UHJDUGLQJ ZHWODQGV FDQ UHGXFH GHOD\VFDXVHG E\ WKH SHUPLWWLQJ SURFHVVDQGFRVWO\FKDQJHVLQVLWHSODQV 12 5()(5(1&(6 &RZDUGLQ/0&DUWHU9*ROHW)'DQG/D5RH(7 ³&ODVVLILFDWLRQRI:HWODQGVDQG 'HHSZDWHU+DELWDWVRIWKH8QLWHG6WDWHV´):$2%6 86)LVK :LOGOLIH6HUYLFH 2IILFHRI%LRORJLFDO6HUYLFHV:DVKLQJWRQ'& (QYLURQPHQWDO/DERUDWRU\ ³&RUSVRI(QJLQHHUV:HWODQGV'HOLQHDWLRQ0DQXDO´7HFKQLFDO 5HSRUW<86$UP\(QJLQHHU:DWHUZD\V([SHULPHQW6WDWLRQ9LFNVEXUJ06 +HUPDQ % 6OLZLQVNL 5 DQG 6 :KLWDNHU &KLFDJR 5HJLRQ)4$ )ORULVWLF4XDOLW\ $VVHVVPHQW &DOFXODWRU86$UP\&RUSVRI(QJLQHHUV&KLFDJR,/ ,OOLQRLV'HSDUWPHQWRI1DWXUDO5HVRXUFHV³$JHQF\$FWLRQ3ODQVIRU,QWHUDJHQF\:HWODQGV3ROLF\ $FWRI ´KWWS GQUVWDWHLOXVZHWODQGVFKGKWP .HQGDOO &RXQW\ 6WRUPZDWHU 0DQDJHPHQW 2UGLQDQFH $GRSWHG 'HFHPEHU 5HYLVHG 2FWREHU /LFKYDU5:'/%DQNV:1.LUFKQHUDQG1&0HOYLQ7KH1DWLRQDO:HWODQG3ODQW /LVW ZHWODQGUDWLQJV3K\WRQHXURQ 3XEOLVKHG$SULO,661 ; 0XQVHOO6RLO&RORU&KDUWV*UHWDJ0DFEHWK1HZ:LQGVRU1HZ<RUN 6RLO 6XUYH\ 6WDII 1DWXUDO 5HVRXUFHV &RQVHUYDWLRQ 6HUYLFH 8QLWHG 6WDWHV 'HSDUWPHQW RI $JULFXOWXUH :HE 6RLO 6XUYH\ $YDLODEOH RQOLQH DW WKH IROORZLQJ OLQN KWWSV ZHEVRLOVXUYH\VFHJRYXVGDJRY$FFHVVHG>@ 6ZLQN ) DQG * :LOKHOP ³3ODQWV RI WKH &KLFDJR 5HJLRQ´WK (GLWLRQ ,QGLDQDSROLV ,QGLDQD$FDGHP\RI6FLHQFH 8QLWHG6WDWHV$UP\&RUSVRI(QJLQHHUV5HJLRQDO6XSSOHPHQWWRWKH&RUSVRI(QJLQHHUV :HWODQG 'HOLQHDWLRQ 0DQXDO 0LGZHVW 5HJLRQ 9HUVLRQ , 86$UP\(QJLQHHU 5HVHDUFKDQG'HYHORSPHQW&HQWHU 8QLWHG 6WDWHV $UP\ &RUSV RI (QJLQHHUV 1DWLRQDO :HWODQG 3ODQW /LVW YHUVLRQ KWWS ZHWODQGBSODQWVXVDFHDUP\PLO86$UP\&RUSVRI(QJLQHHUV(QJLQHHU5HVHDUFK DQG 'HYHORSPHQW &HQWHU &ROG 5HJLRQV 5HVHDUFK DQG (QJLQHHULQJ /DERUDWRU\ +DQRYHU1+ 8QLWHG6WDWHV 'HSDUWPHQW RI $JULFXOWXUH 1DWLRQDO )RRG 6HFXULW\$FW PDQXDO 9 1)6$07KLUG(GLWLRQQG$PHQGPHQW'HFHPEHU 8QLWHG6WDWHV'HSDUWPHQWRI$JULFXOWXUH1DWXUDO5HVRXUFHV&RQVHUYDWLRQ6HUYLFH)LHOG ,QGLFDWRUVRI+\GULF6RLOVLQWKH8QLWHG6WDWHV9HUVLRQ/09DVLODV*:+XUWDQG -) %HUNRZLW] HGV 86'$ 15&6 LQ FRRSHUDWLRQ ZLWK WKH 1DWLRQDO 7HFKQLFDO &RPPLWWHHIRU+\GULF6RLOV 8QLWHG6WDWHV'HSDUWPHQWRIWKH$UP\&RUSVRI(QJLQHHUVDQG86(QYLURQPHQWDO3URWHFWLRQ $JHQF\³&OHDQ:DWHU$FW-XULVGLFWLRQ)ROORZLQJWKH866XSUHPH&RXUW¶V'HFLVLRQLQ 5DSDQRVY8QLWHG6WDWHV &DUDEHOOY8QLWHG6WDWHV´'HFHPEHU 13 8QLWHG 6WDWHV 'HSDUWPHQW RI WKH $UP\ &RUSV RI (QJLQHHUV ³1DWLRQZLGH 3HUPLW 3URJUDP´ -DQXDU\ 8QLWHG6WDWHV*RYHUQPHQW-RLQW*XLGDQFH)URP7KH1DWXUDO5HVRXUFHV&RQVHUYDWLRQ6HUYLFH $QG7KH$UP\&RUSV2I(QJLQHHUV&RQFHUQLQJ:HWODQG'HWHUPLQDWLRQV)RU7KH&OHDQ :DWHU$FW$QG7KH)RRG6HFXULW\$FW2I 0DUFK :LOKHOP* DQG / 5HULFKD ³)ORUD RI WKH &KLFDJR 5HJLRQ $ )ORULVWLF DQG (FRORJLFDO 6\QWKHVLV´,QGLDQDSROLV ,QGLDQD$FDGHP\RI6FLHQFH 86):66HFWLRQ&RQVXOWDWLRQ5HYLHZ6XPPDU\ 2IILFLDO7KUHDWHQHG (QGDQJHUHG6SHFLHV/LVW -XO\ 86)LVKDQG:LOGOLIH6HUYLFH ,OOLQRLV,RZD)LHOG2IILFH WK$YHQXH 0ROLQH,/ 5H 86):65HYLHZ6XPPDU\6HFWLRQ(QGDQJHUHG6SHFLHV$FW&RQVXOWDWLRQ 3URMHFW %HHFKHU5RDG,OOLQRLV.HQGDOO&RXQW\%ULVWRO7RZQVKLS3ODQR71 5(6HFWLRQV /DWLWXGH /RQJLWXGH (1&$3,QFSURMHFW) &OLHQW *UHHQEHUJ)DUURZ 7KHSURMHFWDUHDFRQVLVWVRIDJULFXOWXUDOODQGXVHGIRUWKHSURGXFWLRQRIURZFURSVPRVWUHFHQWO\ SODQWHGZLWK&RUQ Zea mays 5RE5R\&UHHNDQGLWVDVVRFLDWHGZHWODQGLVORFDWHGHDVWRIWKH VLWH7KHVLWHGRHVQRWFRQWDLQDQ\EXLOGLQJVRUVWUXFWXUHV7KHWRSRJUDSK\RIWKHVLWHLVJHQWO\ UROOLQJ7KHSURSRVHGSURMHFWLQFOXGHVWKHFRQVWUXFWLRQRIDVRODUIDUP (1&$3 ,QF FDUHIXOO\UHYLHZHG WKH 86 )LVKDQG :LOGOLIH 6HUYLFH 86):6 ,QIRUPDWLRQIRU 3ODQQLQJDQG&RQVXOWDWLRQ ,3$& WHFKQLFDODVVLVWDQFHZHEVLWHRQ-XO\IRUIHGHUDOO\ OLVWHGWKUHDWHQHGDQGHQGDQJHUHGVSHFLHV$FFRUGLQJWRWKHZHEVLWHVSHFLHVDUHOLVWHGDQG PD\ EH SUHVHQW LQ .HQGDOO &RXQW\ WKH,QGLDQD %DW 1RUWKHUQ /RQJ(DUHG %DW DQG (DVWHUQ 3UDLULH)ULQJHG2UFKLG$GGLWLRQDOO\WKH0RQDUFK%XWWHUIO\ Danaus plexippus LVLQFOXGHGDVD FDQGLGDWHVSHFLHV 2QHPDMRUW\SHRIKDELWDWH[LVWVRQWKHSURMHFWDUHD7KHHQWLUHW\RIWKHVLWHLVDJULFXOWXUDOILHOG UHFHQWO\SODQWHGZLWK&RUQ7ZRIDUPHGZHWODQGVDUHORFDWHGRQWKHVLWH ERWKDUHRIORZTXDOLW\ DQGGRQRWKDUERUKDELWDWIRUWKHDERYHOLVWHGVSHFLHV 1RQHRIWKHDUHDVRQVLWHFRQWDLQVXLWDEOHKDELWDWVIRUWKH,QGLDQD%DW1RUWKHUQ/RQJ(DUHG %DW RU (DVWHUQ 3UDLULH)ULQJHG 2UFKLG 7KHUHIRUH (1&$3 ,QFFRQFOXGHV WKDWWKH %HHFKHU 5RDGGRHVQRWFRQWDLQWKHDIRUHPHQWLRQHGOLVWHGVSHFLHVWKHLUKDELWDWVRUGHVLJQDWHGFULWLFDO KDELWDWDQGZLOOKDYH³QRHIIHFW´RQWKHDIRUHPHQWLRQHGVSHFLHV 6XVDQ5RZOH\3:6&:6/(('$3 $VVLVWDQW9LFH3UHVLGHQW(FRORJLFDO&RQVXOWLQJ'LUHFWRU (1&$3,QF July 22, 2022 United States Department of the Interior FISH AND WILDLIFE SERVICE Illinois-Iowa Ecological Services Field Office Illinois & Iowa Ecological Services Field Office 1511 47th Ave Moline, IL 61265-7022 Phone: (309) 757-5800 Fax: (309) 757-5807 In Reply Refer To: Project Code: 2022-0066722 Project Name: Beecher Road Subject: List of threatened and endangered species that may occur in your proposed project location or may be affected by your proposed project To Whom It May Concern: The enclosed species list identifies threatened, endangered, proposed and candidate species, as well as proposed and final designated critical habitat, that may occur within the boundary of your proposed project and/or may be affected by your proposed project. The species list fulfills the requirements of the U.S. Fish and Wildlife Service (Service) under section 7(c) of the Endangered Species Act (Act) of 1973, as amended (16 U.S.C. 1531 et seq.). New information based on updated surveys, changes in the abundance and distribution of species, changed habitat conditions, or other factors could change this list. Please feel free to contact us if you need more current information or assistance regarding the potential impacts to federally proposed, listed, and candidate species and federally designated and proposed critical habitat. Please note that under 50 CFR 402.12(e) of the regulations implementing section 7 of the Act, the accuracy of this species list should be verified after 90 days. This verification can be completed formally or informally as desired. The Service recommends that verification be completed by visiting the ECOS-IPaC website at regular intervals during project planning and implementation for updates to species lists and information. An updated list may be requested through the ECOS-IPaC system by completing the same process used to receive the enclosed list. The purpose of the Act is to provide a means whereby threatened and endangered species and the ecosystems upon which they depend may be conserved. Under sections 7(a)(1) and 7(a)(2) of the Act and its implementing regulations (50 CFR 402 et seq.), Federal agencies are required to utilize their authorities to carry out programs for the conservation of threatened and endangered species and to determine whether projects may affect threatened and endangered species and/or designated critical habitat. A Biological Assessment is required for construction projects (or other undertakings having similar physical impacts) that are major Federal actions significantly affecting the quality of the human environment as defined in the National Environmental Policy Act (42 U.S.C. 4332(2) 07/22/2022 2 (c)). For projects other than major construction activities, the Service suggests that a biological evaluation similar to a Biological Assessment be prepared to determine whether the project may affect listed or proposed species and/or designated or proposed critical habitat. Recommended contents of a Biological Assessment are described at 50 CFR 402.12. If a Federal agency determines, based on the Biological Assessment or biological evaluation, that listed species and/or designated critical habitat may be affected by the proposed project, the agency is required to consult with the Service pursuant to 50 CFR 402. In addition, the Service recommends that candidate species, proposed species and proposed critical habitat be addressed within the consultation. More information on the regulations and procedures for section 7 consultation, including the role of permit or license applicants, can be found in the "Endangered Species Consultation Handbook" at: http://www.fws.gov/endangered/esa-library/pdf/TOC-GLOS.PDF Migratory Birds: In addition to responsibilities to protect threatened and endangered species under the Endangered Species Act (ESA), there are additional responsibilities under the Migratory Bird Treaty Act (MBTA) and the Bald and Golden Eagle Protection Act (BGEPA) to protect native birds from project-related impacts. Any activity, intentional or unintentional, resulting in take of migratory birds, including eagles, is prohibited unless otherwise permitted by the U.S. Fish and Wildlife Service (50 C.F.R. Sec. 10.12 and 16 U.S.C. Sec. 668(a)). For more information regarding these Acts see https://www.fws.gov/birds/policies-and-regulations.php. The MBTA has no provision for allowing take of migratory birds that may be unintentionally killed or injured by otherwise lawful activities. It is the responsibility of the project proponent to comply with these Acts by identifying potential impacts to migratory birds and eagles within applicable NEPA documents (when there is a federal nexus) or a Bird/Eagle Conservation Plan (when there is no federal nexus). Proponents should implement conservation measures to avoid or minimize the production of project-related stressors or minimize the exposure of birds and their resources to the project-related stressors. For more information on avian stressors and recommended conservation measures see https://www.fws.gov/birds/bird-enthusiasts/threats-to- birds.php. In addition to MBTA and BGEPA, Executive Order 13186: Responsibilities of Federal Agencies to Protect Migratory Birds, obligates all Federal agencies that engage in or authorize activities that might affect migratory birds, to minimize those effects and encourage conservation measures that will improve bird populations. Executive Order 13186 provides for the protection of both migratory birds and migratory bird habitat. For information regarding the implementation of Executive Order 13186, please visit https://www.fws.gov/birds/policies-and-regulations/ executive-orders/e0-13186.php. We appreciate your concern for threatened and endangered species. The Service encourages Federal agencies to include conservation of threatened and endangered species into their project planning to further the purposes of the Act. Please include the Consultation Code in the header of this letter with any request for consultation or correspondence about your project that you submit to our office. 07/22/2022 3 Ƒ Ƒ Ƒ Attachment(s): Official Species List USFWS National Wildlife Refuges and Fish Hatcheries Wetlands 07/22/2022 1 Official Species List This list is provided pursuant to Section 7 of the Endangered Species Act, and fulfills the requirement for Federal agencies to "request of the Secretary of the Interior information whether any species which is listed or proposed to be listed may be present in the area of a proposed action". This species list is provided by: Illinois-Iowa Ecological Services Field Office Illinois & Iowa Ecological Services Field Office 1511 47th Ave Moline, IL 61265-7022 (309) 757-5800 07/22/2022 2 Project Summary Project Code: 2022-0066722 Event Code: None Project Name: Beecher Road Project Type: Power Gen - Solar Project Description: Potential solar farm. Project Location: Approximate location of the project can be viewed in Google Maps: https:// www.google.com/maps/@41.67854535,-88.46923531989498,14z Counties: Kendall County, Illinois 07/22/2022 3 1. Endangered Species Act Species There is a total of 4 threatened, endangered, or candidate species on this species list. Species on this list should be considered in an effects analysis for your project and could include species that exist in another geographic area. For example, certain fish may appear on the species list because a project could affect downstream species. IPaC does not display listed species or critical habitats under the sole jurisdiction of NOAA Fisheries , as USFWS does not have the authority to speak on behalf of NOAA and the Department of Commerce. See the "Critical habitats" section below for those critical habitats that lie wholly or partially within your project area under this office's jurisdiction. Please contact the designated FWS office if you have questions. NOAA Fisheries, also known as the National Marine Fisheries Service (NMFS), is an office of the National Oceanic and Atmospheric Administration within the Department of Commerce. Mammals NAME STATUS Indiana Bat Myotis sodalis There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/5949 Endangered Northern Long-eared Bat Myotis septentrionalis No critical habitat has been designated for this species. Species profile: https://ecos.fws.gov/ecp/species/9045 Threatened Insects NAME STATUS Monarch Butterfly Danaus plexippus No critical habitat has been designated for this species. Species profile: https://ecos.fws.gov/ecp/species/9743 Candidate Flowering Plants NAME STATUS Eastern Prairie Fringed Orchid Platanthera leucophaea No critical habitat has been designated for this species. Species profile: https://ecos.fws.gov/ecp/species/601 Threatened Critical habitats THERE ARE NO CRITICAL HABITATS WITHIN YOUR PROJECT AREA UNDER THIS OFFICE'S JURISDICTION. 1 07/22/2022 4 07/22/2022 1 USFWS National Wildlife Refuge Lands And Fish Hatcheries Any activity proposed on lands managed by the National Wildlife Refuge system must undergo a 'Compatibility Determination' conducted by the Refuge. Please contact the individual Refuges to discuss any questions or concerns. THERE ARE NO REFUGE LANDS OR FISH HATCHERIES WITHIN YOUR PROJECT AREA. 07/22/2022 1 Wetlands Impacts to NWI wetlands and other aquatic habitats may be subject to regulation under Section 404 of the Clean Water Act, or other State/Federal statutes. For more information please contact the Regulatory Program of the local U.S. Army Corps of Engineers District. Please note that the NWI data being shown may be out of date. We are currently working to update our NWI data set. We recommend you verify these results with a site visit to determine the actual extent of wetlands on site. THERE ARE NO WETLANDS WITHIN YOUR PROJECT AREA. 07/22/2022 2 IPaC User Contact Information Agency: ENCAP, Inc. Name: Susan Rowley Address: 2585 Wagner Court Address Line 2: -- City: DeKalb State: IL Zip: 60115 Email srowley@encapinc.net Phone: 8157484500 ,'15(FR&$71DWXUDO5HVRXUFHV5HYLHZ5HVXOWV Applicant: IDNR Project Number: Address: Contact:Susan Rowley 2585 Wagner Court DeKalb, IL 60115 Alternate Number: Date: 22-0513F Project: Address: Beecher Road Beecher Road, Plano Description:Proposed solar farm. 07/22/2022 2301357ENCAP, Inc. Natural Resource Review Results Consultation for Endangered Species Protection and Natural Areas Preservation (Part 1075) The Illinois Natural Heritage Database shows the following protected resources may be in the vicinity of the project location: Mottled Sculpin (Cottus bairdii) Mottled Sculpin (Cottus bairdii) An IDNR staff member will evaluate this information and contact you to request additional information or to terminate consultation if adverse effects are unlikely. Location The applicant is responsible for the accuracy of the location submitted for the project. County:Kendall Township, Range, Section: 37N, 7E, 17 37N, 7E, 18 Government Jurisdiction Kendall County Planning, Building, and Zoning 111 W Fox Street Room 203 Yorkville, Illinois 60560 IL Department of Natural Resources Contact Kyle Burkwald 217-785-5500 Division of Ecosystems & Environment Disclaimer The Illinois Natural Heritage Database cannot provide a conclusive statement on the presence, absence, or condition of natural resources in Illinois. This review reflects the information existing in the Database at the time of this inquiry, and should not be regarded as a final statement on the site being considered, nor should it be a substitute for detailed site surveys or field surveys required for environmental assessments. If additional protected resources are encountered during the project¶s implementation, compliance with applicable statutes and regulations is required. Page 1 of 3 Terms of Use By using this website, you acknowledge that you have read and agree to these terms. These terms may be revised by IDNR as necessary. If you continue to use the EcoCAT application after we post changes to these terms, it will mean that you accept such changes. If at any time you do not accept the Terms of Use, you may not continue to use the website. 1. The IDNR EcoCAT website was developed so that units of local government, state agencies and the public could request information or begin natural resource consultations on-line for the Illinois Endangered Species Protection Act, Illinois Natural Areas Preservation Act, and Illinois Interagency Wetland Policy Act. EcoCAT uses databases, Geographic Information System mapping, and a set of programmed decision rules to determine if proposed actions are in the vicinity of protected natural resources. By indicating your agreement to the Terms of Use for this application, you warrant that you will not use this web site for any other purpose. 2. Unauthorized attempts to upload, download, or change information on this website are strictly prohibited and may be punishable under the Computer Fraud and Abuse Act of 1986 and/or the National Information Infrastructure Protection Act. 3. IDNR reserves the right to enhance, modify, alter, or suspend the website at any time without notice, or to terminate or restrict access. Security EcoCAT operates on a state of Illinois computer system. We may use software to monitor traffic and to identify unauthorized attempts to upload, download, or change information, to cause harm or otherwise to damage this site. Unauthorized attempts to upload, download, or change information on this server is strictly prohibited by law. Unauthorized use, tampering with or modification of this system, including supporting hardware or software, may subject the violator to criminal and civil penalties. In the event of unauthorized intrusion, all relevant information regarding possible violation of law may be provided to law enforcement officials. Privacy EcoCAT generates a public record subject to disclosure under the Freedom of Information Act. Otherwise, IDNR uses the information submitted to EcoCAT solely for internal tracking purposes. Page 2 of 3 IDNR Project Number: 2301357 EcoCAT Receipt Project Code 2301357 APPLICANT DATE 7/22/2022 DESCRIPTION CONVENIENCE FEEFEE TOTAL PAID EcoCAT Consultation $ 125.00 $ 2.81 TOTAL PAID Illinois Department of Natural Resources One Natural Resources Way Springfield, IL 62702 217-785-5500 dnr.ecocat@illinois.gov 127.81 127.81 ENCAP, Inc. Susan Rowley 2585 Wagner Court DeKalb, IL 60115 $ $ Page 3 of 3 IDNR Project Number: 2301357 )ORULVWLF4XDOLW\'DWD6KHHWV SITE:Beecher Road LOCALE:Farmed Wetland 1 BY:S. Rowley NOTES:6/14/2022 CONSERVATISM- BASED METRICS ADDITIONAL METRICS MEAN C (NATIVE SPECIES)0.00 SPECIES RICHNESS (ALL)6 MEAN C (ALL SPECIES)0.00 SPECIES RICHNESS (NATIVE)1 MEAN C (NATIVE TREES)n/a % NON-NATIVE 0.83 MEAN C (NATIVE SHRUBS)n/a WET INDICATOR (ALL)0.33 MEAN C (NATIVE HERBACEOUS)0.00 WET INDICATOR (NATIVE)-1.00 FQAI (NATIVE SPECIES)0.00 % HYDROPHYTE (MIDWEST)0.50 FQAI (ALL SPECIES)0.00 % NATIVE PERENNIAL 0.00 ADJUSTED FQAI 0.00 % NATIVE ANNUAL 0.17 % C VALUE 0 1.00 % ANNUAL 0.67 % C VALUE 1-3 0.00 % PERENNIAL 0.33 % C VALUE 4-6 0.00 % C VALUE 7-10 0.00 SPECIES ACRONYM SPECIES NAME (NWPL/ MOHLENBROCK) SPECIES (SYNONYM) COMMON NAME C VALUE MIDWEST WET INDICATOR NC-NE WET INDICATOR WET INDICATOR (NUMERIC)HABIT DURATION NATIVITY chealb Chenopodium album CHENOPODIU M ALBUM; Chenopodium missouriense Lamb's-Quarters 0 FACU FACU 1 Forb Annual Adventive permac Persicaria maculosa POLYGONUM PERSICARIA Lady's-Thumb 0 FACW FAC -1 Forb Annual Adventive perpen Persicaria pensylvanica Polygonum pensylvanicu m Pinkweed 0 FACW FACW -1 Forb Annual Native phaaru Phalaris arundinacea PHALARIS ARUNDINACE A Reed Canary Grass 0 FACW FACW -1 Grass Perennial Adventive veroff Veronica officinalis VERONICA OFFICINALIS Common Gypsyweed 0 UPL FACU 2 Forb Perennial Adventive zeamay Zea mays ZEA MAYS Corn 0 UPL UPL 2 Grass Annual Adventive SITE:Beecher Road LOCALE:Farmed Wetland 2 BY:S. Rowley NOTES:6/14/2022 CONSERVATISM- BASED METRICS ADDITIONAL METRICS MEAN C (NATIVE SPECIES)0.25 SPECIES RICHNESS (ALL)7 MEAN C (ALL SPECIES)0.14 SPECIES RICHNESS (NATIVE)4 MEAN C (NATIVE TREES)1.00 % NON-NATIVE 0.43 MEAN C (NATIVE SHRUBS)n/a WET INDICATOR (ALL)0.00 MEAN C (NATIVE HERBACEOUS)0.00 WET INDICATOR (NATIVE)-1.00 FQAI (NATIVE SPECIES)0.50 % HYDROPHYTE (MIDWEST)0.57 FQAI (ALL SPECIES)0.38 % NATIVE PERENNIAL 0.29 ADJUSTED FQAI 1.89 % NATIVE ANNUAL 0.29 % C VALUE 0 0.86 % ANNUAL 0.57 % C VALUE 1-3 0.14 % PERENNIAL 0.43 % C VALUE 4-6 0.00 % C VALUE 7-10 0.00 SPECIES ACRONYM SPECIES NAME (NWPL/ MOHLENBROCK) SPECIES (SYNONYM) COMMON NAME C VALUE MIDWEST WET INDICATOR NC-NE WET INDICATOR WET INDICATOR (NUMERIC)HABIT DURATION NATIVITY acesai Acer saccharinum Acer saccharinum Silver Maple 1 FACW FACW -1 Tree Perennial Native broine Bromus inermis BROMUS INERMIS Smooth Brome 0 FACU UPL 1 Grass Perennial Adventive chealb Chenopodium album CHENOPODIU M ALBUM; Chenopodium missouriense Lamb's-Quarters 0 FACU FACU 1 Forb Annual Adventive cypesc Cyperus esculentus Cyperus esculentus Chufa 0 FACW FACW -1 Sedge Perennial Native echcru Echinochloa crus- galli Echinochloa crusgalli Large Barnyard Grass 0 FACW FAC -1 Grass Annual Native perpen Persicaria pensylvanica Polygonum pensylvanicu m Pinkweed 0 FACW FACW -1 Forb Annual Native zeamay Zea mays ZEA MAYS Corn 0 UPL UPL 2 Grass Annual Adventive SITE:Beecher Road LOCALE: Off-Site Wetland 1 / Rob Roy Creek BY:S. Rowley NOTES:6/14/2022 CONSERVATISM- BASED METRICS ADDITIONAL METRICS MEAN C (NATIVE SPECIES)2.42 SPECIES RICHNESS (ALL)18 MEAN C (ALL SPECIES)1.61 SPECIES RICHNESS (NATIVE)12 MEAN C (NATIVE TREES)1.00 % NON-NATIVE 0.33 MEAN C (NATIVE SHRUBS)4.00 WET INDICATOR (ALL)-0.06 MEAN C (NATIVE HERBACEOUS)3.33 WET INDICATOR (NATIVE)-0.25 FQAI (NATIVE SPECIES)8.37 % HYDROPHYTE (MIDWEST)0.72 FQAI (ALL SPECIES)6.84 % NATIVE PERENNIAL 0.67 ADJUSTED FQAI 19.73 % NATIVE ANNUAL 0.00 % C VALUE 0 0.39 % ANNUAL 0.00 % C VALUE 1-3 0.44 % PERENNIAL 0.94 % C VALUE 4-6 0.11 % C VALUE 7-10 0.06 SPECIES ACRONYM SPECIES NAME (NWPL/ MOHLENBROCK) SPECIES (SYNONYM) COMMON NAME C VALUE MIDWEST WET INDICATOR NC-NE WET INDICATOR WET INDICATOR (NUMERIC)HABIT DURATION NATIVITY aceneg Acer negundo Acer negundo var. violaceum Ash-Leaf Maple 0 FAC FAC 0 Tree Perennial Native acesai Acer saccharinum Acer saccharinum Silver Maple 1 FACW FACW -1 Tree Perennial Native apocan Apocynum cannabinum Apocynum sibiricum Indian-Hemp 2 FAC FAC 0 Forb Perennial Native celocc Celtis occidentalis Celtis occidentalis Common Hackberry 2 FAC FAC 0 Tree Perennial Native geulac Geum laciniatum Geum laciniatum Rough Avens 3 FACW FACW -1 Forb Perennial Native leeory Leersia oryzoides Leersia oryzoides Rice Cut Grass 3 OBL OBL -2 Grass Perennial Native lonmaa Lonicera maackii LONICERA MAACKII Amur Honeysuckle 0 UPL UPL 2 Shrub Perennial Adventive mellof Melilotus officinalis MELILOTUS ALBA Yellow Sweet- Clover 0 FACU FACU 1 Forb Biennial Adventive moralb Morus alba MORUS ALBA VAR. TATARICA White Mulberry 0 FAC FACU 0 Tree Perennial Adventive phaaru Phalaris arundinacea PHALARIS ARUNDINACE A Reed Canary Grass 0 FACW FACW -1 Grass Perennial Adventive rhacat Rhamnus cathartica RHAMNUS CATHARTICA European Buckthorn 0 FAC FAC 0 Shrub Perennial Adventive rhuhir Rhus hirta Rhus typhina Staghorn Sumac 1 UPL UPL 2 Tree Perennial Native rudlac Rudbeckia laciniata Rudbeckia laciniata Green-Head Coneflower 4 FACW FACW -1 Forb Perennial Native rumcri Rume crispus RUME CRISPUS Curly Dock 0 FAC FAC 0 Forb Perennial Adventive samcan Sambucus nigra ssp. canadensis Sambucus canadensis Black Elder 4 FAC FACW -1 Shrub Perennial Native solalt Solidago altissima Solidago altissima Tall Goldenrod 1 FACU FACU 1 Forb Perennial Native thadio Thalictrum dioicum Thalictrum dioicum Early Meadow-Rue 7 FACU FACU 1 Forb Perennial Native vitrip Vitis riparia Vitis riparia var. syrticola River-Bank Grape 1 FACW FAC -1 Vine Perennial Native :HWODQG'HWHUPLQDWLRQ'DWD)RUPV 'DWD)RUP3DJHRI :(7/$1''(7(50,1$7,21'$7$)250±0LGZHVW5HJLRQ 3URMHFW6LWH %HHFKHU5RDG &LW\&RXQW\ 3ODQR.HQGDOO 6DPSOLQJ'DWH $SSOLFDQW2ZQHU *UHHQEHUJ)DUURZ 6WDWH ,/ 6DPSOLQJ3RLQW $ ,QYHVWLJDWRU V 65RZOH\ 6HFWLRQ7RZQVKLS5DQJH 6715( /DQGIRUP KLOOVORSHWHUUDFHHWF $JULFXOWXUDO)LHOG /RFDO5HOLHI FRQFDYHFRQYH[QRQH &RQFDYH 6ORSH /DW /RQJ 'DWXP )DUPHG:HWODQG 6RLO0DS8QLW1DPH 3HRWRQHVLOW\FOD\ORDPWRSHUFHQWVORSHV $ 1:,FODVVLILFDWLRQ 1RQH $UHFOLPDWLFK\GURORJLFFRQGLWLRQVRQWKHVLWHW\SLFDOIRUWKLVWLPHRI\HDU" <HV1R ,IQRH[SODLQLQUHPDUNV $UHYHJHWDWLRQ 6RLO +\GURORJ\ VLJQLILFDQWO\GLVWXUEHG" $UHQRUPDOFLUFXPVWDQFHVSUHVHQW" <HV1R $UHYHJHWDWLRQ 6RLO +\GURORJ\ QDWXUDOO\SUREOHPDWLF" ,IQHHGHGH[SODLQDQ\DQVZHUVLQ5HPDUNV 6800$5<2)),1',1*6±$WWDFKVLWHPDSVKRZLQJVDPSOLQJSRLQWORFDWLRQVWUDQVHFWVLPSRUWDQWIHDWXUHVHWF +\GURSK\WLF9HJHWDWLRQ3UHVHQW" <HV1R ,VWKH6DPSOHG$UHD:LWKLQD:HWODQG"<HV1R+\GULF6RLOV3UHVHQW" <HV1R :HWODQG+\GURORJ\3UHVHQW" <HV1R 5HPDUNV 3UHFLSLWDWLRQGDWDIURPWKHSUHYLRXVPRQWKVLQGLFDWHVWKHFOLPDWLFK\GURORJLFFRQGLWLRQVKDYHEHHQQRUPDO7LOHGDQG7LOOHG DJULFXOWXUHILHOG7KLVDUHDPHHWVWKHK\GULFVRLOVDQGK\GURORJ\FULWHULDIRUIDUPHGZHWODQGVWDWXV &RRUGLQDWHVREWDLQHGIURP*RRJOH(DUWK 9(*(7$7,21±8VHVFLHQWLILFQDPHVRISODQWV 7UHH6WUDWXP 3ORWVL]H ¶ $EVROXWH &RYHU 'RPLQDQW 6SHFLHV" ,QGLFDWRU 6WDWXV 'RPLQDQFH7HVWZRUNVKHHW 1XPEHURI'RPLQDQW6SHFLHV 7KDWDUH2%/)$&:RU)$& $ 7RWDO1XPEHURI'RPLQDQW 6SHFLHV $FURVV$OO6WUDWD % 3HUFHQWRI'RPLQDQW6SHFLHV 7KDWDUH2%/)$&:RU)$& $% 7RWDO&RYHU 6DSOLQJ6KUXE6WUDWXP 3ORWVL]H ¶ 3UHYDOHQFH,QGH[ZRUNVKHHW 7RWDO&RYHURI 0XOWLSO\E\ 2%/VSHFLHV [ )$&:VSHFLHV [ )$&VSHFLHV[ 7RWDO&RYHU )$&8VSHFLHV [ +HUE6WUDWXP 3ORWVL]H ¶ 83/VSHFLHV [ en p ium al um 1 )$&8 727$/6 $ % 3UHYDOHQFH,QGH[ %$ BBBBBBBB +\GURSK\WLF9HJHWDWLRQ,QGLFDWRUV 5DSLG7HVWIRU+\GURSK\WLF9HJHWDWLRQ 'RPLQDQFH7HVWLV! 3UHYDOHQFH,QGH[LV 0RUSKRORJLFDO$GDSWDWLRQV 3URYLGHVXSSRUWLQJ GDWDLQ5HPDUNVRURQDVHSDUDWHVKHHW 3UREOHPDWLF+\GURSK\WLF9HJHWDWLRQ ([SODLQ ,QGLFDWRUVRIK\GULFVRLODQGZHWODQGK\GURORJ\ PXVWEHSUHVHQWXQOHVVGLVWXUEHGRUSUREOHPDWLF 7RWDO&RYHU :RRG\9LQH6WUDWXP 3ORWVL]H ¶ +\GURSK\WLF9HJHWDWLRQ3UHVHQW"<HV 1R 7RWDO&RYHU 5HPDUNV ,QFOXGHSKRWRQXPEHUVKHUHRURQDVHSDUDWHVKHHW 3KRWRJUDSK 'DWD)RUP3DJHRI 62,/6DPSOLQJ3RLQW$ 3URILOH'HVFULSWLRQ 'HVFULEHWKHGHSWKQHHGHGWRGRFXPHQWWKHLQGLFDWRURUFRQILUPWKHDEVHQFHRILQGLFDWRUV 'HSWK BBBBBB0DWUL[BBBBBBBBBBBBBBB5HGR[)HDWXUHVBBBBBBBBBBBBBB ,QFKHV &RORU 0RLVW BBBB&RORU 0RLVW BBBBB7\SHBB/RFBBB7H[WXUHBBBBBBBBBBBB5HPDUNVBBBBBBBBBBB BB<5BBBB BB B6L&/B BB<5 <5'0 6L& <5 <5&0 & BBBBBB BBBB BB BB BBBBBB BBBB BB BB BBBBBB BBBB BB BB 7\SH & &RQFHQWUDWLRQ' 'HSOHWLRQ50 5HGXFHG0DWUL[&6 &RYHUHGRU&RDWHG6DQG*UDLQV/RFDWRQ 3/ 3RUH/LQLQJ0 0DWUL[ +\GULF6RLO,QGLFDWRUV ,QGLFDWRUVIRU3UREOHPDWLF+\GULF6RLOV &RDVW3UDLULH5HGR[ $ +LVWRVRO $ 6DQG\*OH\HG0DWUL[ 6 +LVWLF(SLSHGRQ $ 6DQG\5HGR[ 6 'DUN6XUIDFH 6 %ODFN+LVWLF $ 6WULSSHG0DWUL[ 6 ,URQ0DQJDQHVH0DVVHV ) +\GURJHQ6XOILGH $ /RDP\0XFN\0LQHUDO ) 9HU\6KDOORZ'DUN6XUIDFH 7) 6WUDWLILHG/D\HUV $ /RDP\*OH\HG0DWUL[ ) 2WKHU ([SODLQLQ5HPDUNV FP0XFN $ 'HSOHWHG0DWUL[ ) 'HSOHWHGEHORZ'DUN6XUIDFH $ 5HGR['DUN6XUIDFH ) 7KLFN'DUN6XUIDFH $ 'HSOHWHG'DUN6XUIDFH ) ,QGLFDWRUVRIK\GURSK\WLFYHJHWDWLRQDQGZHWODQG K\GURORJ\PXVWEHSUHVHQWXQOHVVGLVWXUEHGRU SUREOHPDWLF 6DQG\0XFN\0LQHUDO 6 5HGR['HSUHVVLRQV ) FP0XFN\3HDWRU3HDW 6 5HVWULFWLYH/D\HU LIREVHUYHG +\GULF6RLO3UHVHQW"<HV1R 7\SH 'HSWK 5HPDUNV +<'52/2*< :HWODQG+\GURORJ\,QGLFDWRUV 3ULPDU\,QGLFDWRUV 0LQLPXPRIRQHLVUHTXLUHG FKHFNDOOWKDWDSSO\ 6HFRQGDU\,QGLFDWRUV PLQLPXPRIWZRUHTXLUHG 6XUIDFH:DWHU $ :DWHU6WDLQHG/HDYHV % 6XUIDFH6RLO&UDFNV % +LJK:DWHU7DEOH $ $TXDWLF)DXQD % 'UDLQDJH3DWWHUQV % 6DWXUDWLRQ $ 7UXH$TXDWLF3ODQWV % 'U\6HDVRQ:DWHU7DEOH & :DWHU0DUNV % +\GURJHQ6XOILGH2GRU & &UD\ILVK%XUURZV & 6HGLPHQW'HSRVLWV % 2[LGL]HG5KL]RVSKHUHVRQ/LYLQJ5RRWV & 6DWXUDWLRQ9LVLEOHRQ$HULDO,PDJHU\ & 'ULIW'HSRVLWV % 3UHVHQFHRI5HGXFHG,URQ & 6WXQWHGRU6WUHVVHG3ODQWV ' $OJDO0DWRU&UXVW % 5HFHQW,URQ5HGXFWLRQLQ7LOOHG6RLOV & *HRPRUSKLF3RVLWLRQ ' ,URQ'HSRVLWV % 7KLQ0XFN6XUIDFH & )$&1HXWUDO7HVW ' ,QXQGDWLRQ9LVLEOHRQ$HULDO,PDJHU\ % *DXJHRU:HOO'DWD ' 6SDUVHO\9HJHWDWHG&RQFDYH6XUIDFH % 2WKHU ([SODLQLQ5HPDUNV )LHOG2EVHUYDWLRQV 6XUIDFH:DWHU3UHVHQW" :DWHU7DEOH3UHVHQW" 6DWXUDWLRQ3UHVHQW" LQFOXGHVFDSLOODU\IULQJH <HV1R 'HSWK LQFKHV B1$BBBBBBBBBBB <HV1R 'HSWK LQFKHV B1$BBBBBBBBBBB <HV1R 'HSWK LQFKHV B6XUIDFHBBBBBBBBBBB :HWODQG+\GURORJ\3UHVHQW"<HV 1R 'HVFULEH5HFRUGHG'DWD VWUHDPJDXJHPRQLWRULQJZHOODHULDOSKRWRVSUHYLRXVLQVSHFWLRQV LIDYDLODEOH 5HPDUNV 7KLVDUHDGLVSOD\HGZHWODQGVLJQDWXUHVGXULQJRIUHYLHZHGKLVWRULFDHULDOSKRWRJUDSKVZLWKQRUPDOSUHFLSLWDWLRQ 'DWD)RUP3DJHRI :(7/$1''(7(50,1$7,21'$7$)250±0LGZHVW5HJLRQ 3URMHFW6LWH %HHFKHU5RDG &LW\&RXQW\ 3ODQR.HQGDOO 6DPSOLQJ'DWH $SSOLFDQW2ZQHU *UHHQEHUJ)DUURZ 6WDWH ,/ 6DPSOLQJ3RLQW % ,QYHVWLJDWRU V 65RZOH\ 6HFWLRQ7RZQVKLS5DQJH 6715( /DQGIRUP KLOOVORSHWHUUDFHHWF $JULFXOWXUDO)LHOG /RFDO5HOLHI FRQFDYHFRQYH[QRQH &RQFDYH 6ORSH /DW /RQJ 'DWXP )DUPHG:HWODQG 6RLO0DS8QLW1DPH 3HRWRQHVLOW\FOD\ORDPWRSHUFHQWVORSHV $ 1:,FODVVLILFDWLRQ 1RQH $UHFOLPDWLFK\GURORJLFFRQGLWLRQVRQWKHVLWHW\SLFDOIRUWKLVWLPHRI\HDU" <HV1R ,IQRH[SODLQLQUHPDUNV $UHYHJHWDWLRQ 6RLO +\GURORJ\ VLJQLILFDQWO\GLVWXUEHG" $UHQRUPDOFLUFXPVWDQFHVSUHVHQW" <HV1R $UHYHJHWDWLRQ 6RLO +\GURORJ\ QDWXUDOO\SUREOHPDWLF" ,IQHHGHGH[SODLQDQ\DQVZHUVLQ5HPDUNV 6800$5<2)),1',1*6±$WWDFKVLWHPDSVKRZLQJVDPSOLQJSRLQWORFDWLRQVWUDQVHFWVLPSRUWDQWIHDWXUHVHWF +\GURSK\WLF9HJHWDWLRQ3UHVHQW" <HV1R ,VWKH6DPSOHG$UHD:LWKLQD:HWODQG"<HV1R+\GULF6RLOV3UHVHQW" <HV1R :HWODQG+\GURORJ\3UHVHQW" <HV1R 5HPDUNV 3UHFLSLWDWLRQGDWDIURPWKHSUHYLRXVPRQWKVLQGLFDWHVWKHFOLPDWLFK\GURORJLFFRQGLWLRQVKDYHEHHQQRUPDO7LOHGDQG7LOOHG DJULFXOWXUHILHOG 7KLVDUHDPHHWVWKHK\GULFVRLOVDQGK\GURORJ\FULWHULDIRUIDUPHGZHWODQGVWDWXV &RRUGLQDWHVREWDLQHGIURP*RRJOH(DUWK 9(*(7$7,21±8VHVFLHQWLILFQDPHVRISODQWV 7UHH6WUDWXP 3ORWVL]H ¶ $EVROXWH &RYHU 'RPLQDQW 6SHFLHV" ,QGLFDWRU 6WDWXV 'RPLQDQFH7HVWZRUNVKHHW 1XPEHURI'RPLQDQW6SHFLHV 7KDWDUH2%/)$&:RU)$& $ 7RWDO1XPEHURI'RPLQDQW 6SHFLHV $FURVV$OO6WUDWD % 3HUFHQWRI'RPLQDQW6SHFLHV 7KDWDUH2%/)$&:RU)$& $% 7RWDO&RYHU 6DSOLQJ6KUXE6WUDWXP 3ORWVL]H ¶ 3UHYDOHQFH,QGH[ZRUNVKHHW 7RWDO&RYHURI 0XOWLSO\E\ 2%/VSHFLHV [ )$&:VSHFLHV [ )$&VSHFLHV[ 7RWDO&RYHU )$&8VSHFLHV [ +HUE6WUDWXP 3ORWVL]H ¶ 83/VSHFLHV [ Zea mays 1 83/ 727$/6 $ % en p ium al um 1 )$&83UHYDOHQFH,QGH[ %$ BBBBBBBB e sa ainum 1 )$&: +\GURSK\WLF9HJHWDWLRQ,QGLFDWRUV 5DSLG7HVWIRU+\GURSK\WLF9HJHWDWLRQ 'RPLQDQFH7HVWLV! 3UHYDOHQFH,QGH[LV 0RUSKRORJLFDO$GDSWDWLRQV 3URYLGHVXSSRUWLQJ GDWDLQ5HPDUNVRURQDVHSDUDWHVKHHW 3UREOHPDWLF+\GURSK\WLF9HJHWDWLRQ ([SODLQ ,QGLFDWRUVRIK\GULFVRLODQGZHWODQGK\GURORJ\ PXVWEHSUHVHQWXQOHVVGLVWXUEHGRUSUREOHPDWLF 7RWDO&RYHU :RRG\9LQH6WUDWXP 3ORWVL]H ¶ +\GURSK\WLF9HJHWDWLRQ3UHVHQW"<HV 1R 7RWDO&RYHU 5HPDUNV ,QFOXGHSKRWRQXPEHUVKHUHRURQDVHSDUDWHVKHHW 3KRWRJUDSK 'DWD)RUP3DJHRI 62,/6DPSOLQJ3RLQW% 3URILOH'HVFULSWLRQ 'HVFULEHWKHGHSWKQHHGHGWRGRFXPHQWWKHLQGLFDWRURUFRQILUPWKHDEVHQFHRILQGLFDWRUV 'HSWK BBBBBB0DWUL[BBBBBBBBBBBBBBB5HGR[)HDWXUHVBBBBBBBBBBBBBB ,QFKHV &RORU 0RLVW BBBB&RORU 0RLVW BBBBB7\SHBB/RFBBB7H[WXUHBBBBBBBBBBBB5HPDUNVBBBBBBBBBBB BB<5BBBB BB 6L& <5 <5&0 & BBBBBB BBBB BB BB BBBBBB BBBB BB BB BBBBBB BBBB BB BB BBBBBB BBBB BB BB 7\SH & &RQFHQWUDWLRQ' 'HSOHWLRQ50 5HGXFHG0DWUL[&6 &RYHUHGRU&RDWHG6DQG*UDLQV/RFDWRQ 3/ 3RUH/LQLQJ0 0DWUL[ +\GULF6RLO,QGLFDWRUV ,QGLFDWRUVIRU3UREOHPDWLF+\GULF6RLOV &RDVW3UDLULH5HGR[ $ +LVWRVRO $ 6DQG\*OH\HG0DWUL[ 6 +LVWLF(SLSHGRQ $ 6DQG\5HGR[ 6 'DUN6XUIDFH 6 %ODFN+LVWLF $ 6WULSSHG0DWUL[ 6 ,URQ0DQJDQHVH0DVVHV ) +\GURJHQ6XOILGH $ /RDP\0XFN\0LQHUDO ) 9HU\6KDOORZ'DUN6XUIDFH 7) 6WUDWLILHG/D\HUV $ /RDP\*OH\HG0DWUL[ ) 2WKHU ([SODLQLQ5HPDUNV FP0XFN $ 'HSOHWHG0DWUL[ ) 'HSOHWHGEHORZ'DUN6XUIDFH $ 5HGR['DUN6XUIDFH ) 7KLFN'DUN6XUIDFH $ 'HSOHWHG'DUN6XUIDFH ) ,QGLFDWRUVRIK\GURSK\WLFYHJHWDWLRQDQGZHWODQG K\GURORJ\PXVWEHSUHVHQWXQOHVVGLVWXUEHGRU SUREOHPDWLF 6DQG\0XFN\0LQHUDO 6 5HGR['HSUHVVLRQV ) FP0XFN\3HDWRU3HDW 6 5HVWULFWLYH/D\HU LIREVHUYHG +\GULF6RLO3UHVHQW"<HV1R 7\SH 'HSWK 5HPDUNV +<'52/2*< :HWODQG+\GURORJ\,QGLFDWRUV 3ULPDU\,QGLFDWRUV 0LQLPXPRIRQHLVUHTXLUHG FKHFNDOOWKDWDSSO\ 6HFRQGDU\,QGLFDWRUV PLQLPXPRIWZRUHTXLUHG 6XUIDFH:DWHU $ :DWHU6WDLQHG/HDYHV % 6XUIDFH6RLO&UDFNV % +LJK:DWHU7DEOH $ $TXDWLF)DXQD % 'UDLQDJH3DWWHUQV % 6DWXUDWLRQ $ 7UXH$TXDWLF3ODQWV % 'U\6HDVRQ:DWHU7DEOH & :DWHU0DUNV % +\GURJHQ6XOILGH2GRU & &UD\ILVK%XUURZV & 6HGLPHQW'HSRVLWV % 2[LGL]HG5KL]RVSKHUHVRQ/LYLQJ5RRWV & 6DWXUDWLRQ9LVLEOHRQ$HULDO,PDJHU\ & 'ULIW'HSRVLWV % 3UHVHQFHRI5HGXFHG,URQ & 6WXQWHGRU6WUHVVHG3ODQWV ' $OJDO0DWRU&UXVW % 5HFHQW,URQ5HGXFWLRQLQ7LOOHG6RLOV & *HRPRUSKLF3RVLWLRQ ' ,URQ'HSRVLWV % 7KLQ0XFN6XUIDFH & )$&1HXWUDO7HVW ' ,QXQGDWLRQ9LVLEOHRQ$HULDO,PDJHU\ % *DXJHRU:HOO'DWD ' 6SDUVHO\9HJHWDWHG&RQFDYH6XUIDFH % 2WKHU ([SODLQLQ5HPDUNV )LHOG2EVHUYDWLRQV 6XUIDFH:DWHU3UHVHQW" :DWHU7DEOH3UHVHQW" 6DWXUDWLRQ3UHVHQW" LQFOXGHVFDSLOODU\IULQJH <HV1R 'HSWK LQFKHV B1$BBBBBBBBBBB <HV1R 'HSWK LQFKHV B1$BBBBBBBBBBB <HV1R 'HSWK LQFKHV B1$BBBBBBBBBBB :HWODQG+\GURORJ\3UHVHQW"<HV 1R 'HVFULEH5HFRUGHG'DWD VWUHDPJDXJHPRQLWRULQJZHOODHULDOSKRWRVSUHYLRXVLQVSHFWLRQV LIDYDLODEOH 5HPDUNV 7KLVDUHDGLVSOD\HGZHWODQGVLJQDWXUHVGXULQJRIUHYLHZHGKLVWRULFDHULDOSKRWRJUDSKVZLWKQRUPDOSUHFLSLWDWLRQ 6LWH3KRWRJUDSKV 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ )DUPHG:HWODQG 6DPSOH3RLQW$ )DFLQJ1RUWK '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ )DUPHG:HWODQG 2YHUYLHZ )DFLQJ1RUWKZHVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ )DUPHG:HWODQG 2YHUYLHZ )DFLQJ1RUWK '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ )DUPHG:HWODQG 2YHUYLHZ )DFLQJ1RUWKHDVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ )DUPHG:HWODQG 6DPSOH3RLQW% )DFLQJ:HVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ )DUPHG:HWODQG 2YHUYLHZ )DFLQJ6RXWKHDVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ )DUPHG:HWODQG 2YHUYLHZ )DFLQJ6RXWK '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 2IIVLWH:HWODQG5RE5R\ &UHHN )DFLQJ(DVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 2IIVLWH:HWODQG 5RE5R\ &UHHN )DFLQJ6RXWKHDVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 2IIVLWH:HWODQG5RE5R\ &UHHN )DFLQJ(DVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 6LWH2YHUYLHZ ZHVWHUQ ERXQGDU\ )DFLQJ6RXWK '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 6LWH2YHUYLHZ )DFLQJ6RXWKHDVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 6LWH2YHUYLHZ QRUWKHUQ ERXQGDU\ )DFLQJ(DVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 6LWH2YHUYLHZ )DFLQJ 6RXWKZHVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 6LWH2YHUYLHZ HDVWHUQ ERXQGDU\ )DFLQJ6RXWK '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 6LWH2YHUYLHZ )DFLQJ1RUWK '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 6LWH2YHUYLHZ )DFLQJ:HVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 6LWH2YHUYLHZ VRXWKHUQ ERXQGDU\ )DFLQJ6RXWKZHVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 6LWH2YHUYLHZ UDLOURDGULJKW RIZD\QRZHWODQG )DFLQJ6RXWKHDVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 6LWH2YHUYLHZ )DFLQJ(DVW '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ %HHFKHU5RDG 5LJKWRI:D\ QRZHWODQG )DFLQJ1RUWK '$7(3+2727$.(1 -XQH 3+272*5$3+ '(6&5,37,21 %HHFKHU5RDG *UHHQEHUJ)DUURZ 6LWH2YHUYLHZ )DFLQJ1RUWKHDVW '$7(3+2727$.(1 -XQH 86$&($QWHFHGHQW3UHFLSLWDWLRQ7RRO)LJXUH 7DEOHV :(7 +LVWRULFDO$HULDO3KRWRJUDSKV :(7 <HDU 6&$/( 1 0DS6RXUFH *RRJOH(DUWK 1 2 3 4 5 6 7 <HDU 6&$/( 1 0DS6RXUFH *RRJOH(DUWK 1 2 <HDU :(7 6&$/( 1 0DS6RXUFH *RRJOH(DUWK 1 2 3 4 6 5 <HDU 6&$/( 1 0DS6RXUFH *RRJOH(DUWK 1 2 <HDU 6&$/( 1 0DS6RXUFH *RRJOH(DUWK 1 2 3 4 9 5 6 7 8 10 <HDU 6&$/( 1 0DS6RXUFH *RRJOH(DUWK 1 2 ([KLELWV$* /RFDWLRQ0DS 6RXUFH 86*HRORJLFDO6XUYH\ 6HFWLRQ715( /DWLWXGH /RQJLWXGH %HHFKHU5RDG 3URMHFW1XPEHU ) *UHHQEHUJ)DUURZ 1257+ 6&$/( /(*(1' 3URMHFW$UHD ([KLELW$ /(*(1' 3URMHFW$UHD ([KLELW% 1257+ 6&$/( 1DWLRQDO:HWODQGV,QYHQWRU\ 6RXUFH 86)LVK :LOGOLIH6HUYLFH %HHFKHU5RDG 3URMHFW1XPEHU ) *UHHQEHUJ)DUURZ ([KLELW& 1257+ 6&$/( 6RLO0DS 6RXUFH 86'HSDUWPHQWRI$JULFXOWXUH 1DWXUDO5HVRXUFHV&RQVHUYDWLRQ6HUYLFH :HE6RLO6XUYH\ %HHFKHU5RDG 3URMHFW1XPEHU ) *UHHQEHUJ)DUURZ /(*(1' 3URMHFW$UHD ([KLELW' 1257+ 6&$/( 86*67RSRJUDSKLF0DS 6RXUFH 86*HRORJLFDO6XUYH\<RUNYLOOH4XDGUDQJOH %HHFKHU5RDG 3URMHFW1XPEHU ) *UHHQEHUJ)DUURZ /(*(1' 3URMHFW$UHD ([KLELW( 1257+ 6&$/( )ORRG,QVXUDQFH5DWH0DS 6RXUFH )HGHUDO(PHUJHQF\0DQDJHPHQW$JHQF\ )(0$ 3DQHO1XPEHU &+ &* (IIHFWLYH'DWH %HHFKHU5RDG 3URMHFW1XPEHU ) *UHHQEHUJ)DUURZ /(*(1' 3URMHFW$UHD ([KLELW) 6&$/( /(*(1' 3URMHFW$UHD +LVWRULF$UFKLWHFWXUDO5HVRXUFHV *HRJUDSKLF,QIRUPDWLRQ6\VWHP 6RXUFH ,OOLQRLV6WDWH+LVWRULF3UHVHUYDWLRQ2IILFH %HHFKHU5RDG 3URMHFW1XPEHU ) *UHHQEHUJ)DUURZ 1257+ ([KLELW* 6&$/( $HULDO3KRWRJUDSK 0DSGDWD *RRJOH ,PDJH'DWH %HHFKHU5RDG 3URMHFW1XPEHU ) *UHHQEHUJ)DUURZ /(*(1' 3URMHFW$UHD $SSUR[LPDWH2IIVLWH :HWODQG%RXQGDU\ 2QVLWH)DUPHG:HWODQG%RXQGDU\ 6DPSOH3RLQWV $% 1257+ :/'HOLQHDWLRQ)LHOG:RUN &RPSOHWHG )DUPHG:HWODQG $ % )DUPHG:HWODQG 2IIVLWH:HWODQG 5RE5R\&UHHN ,&&3DUW,QWHUFRQQHFWLRQ)DFLOLWLHV6WXG\$JUHHPHQW )L[HG&RVW2SWLRQ'D\&RPSOHWLRQ 7KLVDJUHHPHQW $JUHHPHQW LVPDGHDQGHQWHUHGLQWRWKLV GD\RI E\DQGEHWZHHQ3URMHFW'HYHORSPHQW//& LQWHUFRQQHFWLRQFXVWRPHU DVDQ LQGLYLGXDOSHUVRQRUDVD RUJDQL]HGDQGH[LVWLQJXQGHUWKH ODZVRIWKH6WDWHRI DQG &RPPRQZHDOWK (GLVRQ&RPSDQ\ (OHFWULF'LVWULEXWLRQ &RPSDQ\ ('& D &RUSRUDWLRQ H[LVWLQJXQGHUWKHODZVRIWKH 6WDWHRI,OOLQRLV,QWHUFRQQHFWLRQFXVWRPHUDQG('&HDFKPD\EHUHIHUUHGWRDVD3DUW\RU FROOHFWLYHO\DVWKH3DUWLHV 5HFLWDOV :KHUHDVLQWHUFRQQHFWLRQFXVWRPHULVSURSRVLQJWRGHYHORSDGLVWULEXWHGJHQHUDWLRQIDFLOLW\RU PRGLI\LQJDQH[LVWLQJGLVWULEXWHGJHQHUDWLRQIDFLOLW\FRQVLVWHQWZLWKWKHLQWHUFRQQHFWLRQUHTXHVW DSSOLFDWLRQIRUPFRPSOHWHGE\LQWHUFRQQHFWLRQFXVWRPHURQ )HEUXDU\ DQG :KHUHDVLQWHUFRQQHFWLRQFXVWRPHUGHVLUHVWRLQWHUFRQQHFWWKHGLVWULEXWHGJHQHUDWLRQIDFLOLW\ZLWK ('& VHOHFWULFGLVWULEXWLRQV\VWHP DQG :KHUHDV('&KDVFRPSOHWHGDQLQWHUFRQQHFWLRQV\VWHPLPSDFWVWXG\DQGSURYLGHGWKHUHVXOWVRI VDLGVWXG\WRLQWHUFRQQHFWLRQFXVWRPHU XQOHVVSURFHHGLQJGLUHFWO\IURP/HYHORUUHYLHZ DQG :KHUHDVLQWHUFRQQHFWLRQFXVWRPHUKDVUHTXHVWHG('&WRSHUIRUPDQLQWHUFRQQHFWLRQIDFLOLWLHVVWXG\ WRVSHFLI\DQGHVWLPDWHWKHFRVWRIWKHHTXLSPHQWHQJLQHHULQJSURFXUHPHQWDQGFRQVWUXFWLRQZRUN QHHGHGWRLQWHUFRQQHFWWKHGLVWULEXWHGJHQHUDWLRQIDFLOLW\ 1RZWKHUHIRUHLQFRQVLGHUDWLRQRIDQGVXEMHFWWRWKHPXWXDOFRYHQDQWVFRQWDLQHGLQWKLV$JUHHPHQW WKH3DUWLHVDJUHHDVIROORZV $OOWHUPVGHILQHGLQ6HFWLRQRIWKH,OOLQRLV'LVWULEXWHG*HQHUDWLRQ,QWHUFRQQHFWLRQ 6WDQGDUGVKDOOKDYHWKHPHDQLQJVLQGLFDWHGLQWKDW6HFWLRQZKHQXVHGLQWKLV$JUHHPHQW ,QWHUFRQQHFWLRQFXVWRPHUHOHFWVDQG('&VKDOOFDXVHDQLQWHUFRQQHFWLRQIDFLOLWLHVVWXG\ FRQVLVWHQWZLWK6HFWLRQRIWKH,OOLQRLV'LVWULEXWHG*HQHUDWLRQ,QWHUFRQQHFWLRQ 6WDQGDUG 7KHVFRSHRIWKHLQWHUFRQQHFWLRQIDFLOLWLHVVWXG\VKDOOEHGHWHUPLQHGE\WKHLQIRUPDWLRQ SURYLGHGLQ$WWDFKPHQW$WRWKLV$JUHHPHQW $QLQWHUFRQQHFWLRQIDFLOLWLHVVWXG\UHSRUW VKDOOSURYLGHDGHVFULSWLRQHVWLPDWHGFRVWRI GLVWULEXWLRQXSJUDGHVDQGDVFKHGXOHIRUUHTXLUHGIDFLOLWLHVWRLQWHUFRQQHFWWKHGLVWULEXWHG 7th June limited liability company Delaware JHQHUDWLRQIDFLOLW\WR('& VHOHFWULFGLVWULEXWLRQV\VWHP DQG VKDOODGGUHVVDOOLVVXHV LGHQWLILHGLQWKHLQWHUFRQQHFWLRQV\VWHPLPSDFWVWXG\ RULGHQWLILHGLQWKLVVWXG\LIWKHV\VWHP LPSDFWVWXG\LVFRPELQHGKHUHLQ 1RWZLWKVWDQGLQJDQ\WKLQJWRWKHFRQWUDU\LQ$SSHQGL[*WR3DUWRIWKH,OOLQRLV $GPLQLVWUDWLYH&RGHWKHLQWHUFRQQHFWLRQIDFLOLWLHVVWXG\VKDOOEHFRPSOHWHGDQGWKHUHVXOWV VKDOOEHWUDQVPLWWHGWRWKHLQWHUFRQQHFWLRQFXVWRPHUZLWKLQEXVLQHVVGD\VDIWHUWKLV $JUHHPHQWKDVEHHQVLJQHGE\WKH3DUWLHVRUWKHVWXG\IHHRISXUVXDQWWRLWHPRIWKLV $JUHHPHQWKDVEHHQUHFHLYHGE\WKH('&ZKLFKHYHULVODWHU7KHVWXG\ZLOOQRWFRPPHQFH XQWLOWKHVWXG\IHHKDVEHHQUHFHLYHGE\WKH('& 1RWZLWKVWDQGLQJDQ\WKLQJWRWKHFRQWUDU\LQ$SSHQGL[*WRSDUWRIWKH,OOLQRLV $GPLQLVWUDWLYH&RGHWKHLQWHUFRQQHFWLRQFXVWRPHUDQGWKH('&DJUHHWKHFRVWRIWKH LQWHUFRQQHFWLRQIDFLOLWLHVVWXG\VKDOOEHUHJDUGOHVVRIWKHWLPHDQGPDWHULDOVDFWXDOO\ UHTXLUHGIRUWKHFRQGXFWRIWKHVWXG\DQGWKHLQWHUFRQQHFWLRQFXVWRPHUZLOOQRWEHLQYRLFHGRU RWKHUZLVHSURYLGHGDFWXDOFRVWVRIWKHVWXG\ ,QZLWQHVVZKHUHRIWKH3DUWLHVKDYHFDXVHGWKLV$JUHHPHQWWREHGXO\H[HFXWHGE\WKHLUGXO\ DXWKRUL]HGRIILFHUVRUDJHQWVRQWKHGD\DQG\HDUILUVWDERYHZULWWHQ 3URMHFW'HYHORSPHQW//& 6LJQHG 1DPH 3ULQWHG 7LWOH &RPPRQZHDOWK(GLVRQ&RPSDQ\ 6LJQHG 1DPH 3ULQWHG 7LWOH Stephen Thiel Michael Brigandi Senior Director of Grid Integration Stephen Thiel Principal Contract Specialist $WWDFKPHQW$WR,QWHUFRQQHFWLRQ)DFLOLWLHV6WXG\$JUHHPHQW 0LQLPXP,QIRUPDWLRQ7KDW,QWHUFRQQHFWLRQ&XVWRPHU0XVW3URYLGHZLWKWKH,QWHUFRQQHFWLRQ )DFLOLWLHV6WXG\$JUHHPHQW 3URYLGHORFDWLRQSODQDQGVLPSOLILHGRQHOLQHGLDJUDPRIWKHGLVWULEXWHGJHQHUDWLRQIDFLOLWLHV )RUVWDJHGSURMHFWVSOHDVHLQGLFDWHVL]HDQGORFDWLRQRISODQQHGDGGLWLRQDOIXWXUHJHQHUDWLRQ 2QWKHRQHOLQHGLDJUDPLQGLFDWHWKHJHQHUDWLRQFDSDFLW\DWWDFKHGDWHDFKPHWHULQJORFDWLRQ 0D[LPXPORDGRQ&737 2QWKHRQHOLQHGLDJUDPLQGLFDWHWKHORFDWLRQRIDX[LOLDU\SRZHU 0LQLPXPORDGRQ&737 $PSV 2QHVHWRIPHWHULQJLVUHTXLUHGIRUHDFKJHQHUDWLRQFRQQHFWLRQWRWKH('& VHOHFWULFGLVWULEXWLRQ V\VWHP 1XPEHURIJHQHUDWLRQFRQQHFWLRQV :LOODQDOWHUQDWHVRXUFHRIDX[LOLDU\SRZHUEHDYDLODEOHGXULQJ&737PDLQWHQDQFH" <HV 1R :LOODWUDQVIHUEXVRQWKHJHQHUDWLRQVLGHRIWKHPHWHULQJUHTXLUHWKDWHDFKPHWHUVHWEHGHVLJQHGIRU WKHWRWDOGLVWULEXWHGJHQHUDWLRQFDSDFLW\" <HV 1R 3OHDVHLQGLFDWHRQWKHRQHOLQHGLDJUDP :KDWW\SHRIFRQWUROV\VWHPRU3/&ZLOOEHORFDWHGDWWKHGLVWULEXWHGJHQHUDWLRQIDFLOLW\" :KDWSURWRFROGRHVWKHFRQWUROV\VWHPRU3/&XVH" 3OHDVHSURYLGHDVFDOHGUDZLQJRIWKHVLWH,QGLFDWHWKHSRLQWRIFRPPRQFRXSOLQJGLVWULEXWLRQOLQH DQGSURSHUW\OLQHV 1XPEHURIWKLUGSDUW\HDVHPHQWVUHTXLUHGIRU('& VLQWHUFRQQHFWLRQIDFLOLWLHV 1 X X Utility Recloser SEL-651R2 0 7REHFRPSOHWHGLQFRRUGLQDWLRQZLWK('& ,VWKHGLVWULEXWHGJHQHUDWLRQIDFLOLW\ORFDWHGLQ('& VVHUYLFHDUHD" <HV 1R ,I1RSOHDVHSURYLGHQDPHRIORFDOSURYLGHU 3OHDVHSURYLGHWKHIROORZLQJSURSRVHGVFKHGXOHGDWHV %HJLQFRQVWUXFWLRQGDWH *HQHUDWRUVWHSXSWUDQVIRUPHUVUHFHLYHEDFNIHHGSRZHUGDWH *HQHUDWLRQWHVWLQJGDWH &RPPHUFLDORSHUDWLRQGDWH 6RXUFH $PHQGHGDW,OO5HJHIIHFWLYH-DQXDU\ &RP(G$PHQGHG±)L[HG&RVW2SWLRQDQG'D\&RPSOHWLRQ±-XO\ X 5/16/24 12/02/24 3/12/25 5/11/25 by: Dr. Kevin McGowan Director 28 July 2022 Department of Anthropology 1707 South Orchard Street University of Illinois at Urbana-Champaign, Urbana,Illinois 61801 PUBLIC SERVICEARCHAEOLOGY&ARCHITECTUREPROGRAM ARCHAEOLOGICAL RECONNAISSANCE OF A 27-ACRE SOLAR DEVELOPMENT ON BEECHER ROAD IN KENDALL COUNTY, ILLINOIS Project No. 22-051 for submission to & funded by: Ms. Marisa Kolman Greenberg Farrow Architecture, Inc. 21 South Evergreen Avenue, Suite 200 Arlington Heights, Illinois 60005 ARCHAEOLOGICAL SURVEY SHORT REPORT Illinois Historic Preservation Agency Old State Capitol Building Springfield, Illinois 62701 (217/785-4997) SHPO Log: Locational Information and Survey Conditions County: Kendall Quadrangle:Yorkville 7.5”Project Type/Title:New Construction/ Solar Energy Array – Beecher Road Funding and/or Permitting Federal/State Agencies: IEPA (i.e., CoE, HUD, IEPA, FmHA, etc.) Sec:17, 18 T.: 37 N R.: 07 E Natural Division (No.): 4a U.T.M.:E. 377470 to E. 377975 and N. 4614990 to N. 4615260, UTM Zone 16 North WGS84. Project Description:Project is a proposed solar power collection array facility to be located on Beecher Road roughly 360 meters north of Faxon Road near Yorkville, Illinois. Topography:The project area is located within an area of glacially formed uplands. Soils:Soils mapped as occurring within the project area include: Camden silt loam, 5 to 10 percent slopes, eroded; Brenton silt loam, 0 to 2 percent slopes; Millbrook silt loam, 0 to 2 percent slopes; Peotone silty clay loam, 0 to 2 percent slopes; and Somonauk silt loam, 2 to 5 percent slopes (Natural Resources Conservation Service 2022a). Drainage:Rob Roy Creek. Land Use/Ground Cover (Include % Visibility):The project area is agricultural fields that featured newly planted and emerged corn with 50 percent surface visibility. Survey Limitations: None. Archaeological and Historical Information Historic Plats/Atlases/Sources: See Selected Sources. Previously Reported Sites:11KE115. Previous Surveys: The project area is not recorded as previously surveyed. Regional Archaeologists Contacted:None. Investigation Techniques:The project area was investigated by a 5-meter interval pedestrian reconnaissance. Time Expended:12.0 field hours. Sites/Find Spots Located: 11KE115 – Records Only and 11KE1404. Cultural Material: One core, one tertiary chert flake, and one biface fragment. (Curated at)n/a. Collection Techniques:Representative. Areas Surveyed (Acres & Square Meters):27.0 Acres (109,269 Square Meters). (OVER) REVIEWER_____________________ Date: _______________________ _____Accepted _______Rejected IHPA USE ONLY (Form ASSR0886) Page 2 Results of Investigation and Recommendations: (Check One) ___ Phase I Archaeological Reconnaissance Has Located No Archaeological Material; Project Clearance Is Recommended. XXX Phase I Archaeological Reconnaissance Has Located Archaeological Materials; Site(s) Does (Do) Not Meet Requirements For National Register Eligibility; Project Clearance Is Recommended. ___ Phase I Archaeological Reconnaissance Has Located Archaeological Materials; Site(s) May Meet Requirements For National Register Eligibility; Phase II Testing Is Recommended. Phase II Archaeological Investigation Has Indicated That Site(s) Does (Do) Not Meet Requirements For National Register Eligibility; Project Clearance Is Recommended. Phase II Archaeological Investigation Has Indicated That Site(s) Meet Requirements For National Register Eligibility; Formal Report Is Pending And A Determination of Eligibility Is Recommended. Comments:See Continuation Section. Archaeological Contractor Information: Archaeological Contractor:Public Service Archaeology & Architecture Program Address/Phone:Department of Anthropology (217) 333-1636 1707 South Orchard Street University of Illinois at Urbana-Champaign Urbana, Illinois 61801 Surveyor(s):C. Jones, B. Coker; G. Walz Survey Date(s):July 11, 2022 Report Completed By:Kevin McGowan Date:July 28, 2022 Submitted By (Signature and Title): Director Attachment Check List: (#1 Through #4 Are MANDATORY) xxx 1) Relevant Portion of USGS 7.5' Topographic Quadrangle Map(s) Showing Project Location And Any Recorded Sites; xxx 2) Project Map(s) Depicting Survey Limits And, When Applicable, Approximate Site Limits, And Concentrations of Cultural Materials; xxx 3) Site Form(s): One Copy of Each Form; xxx 4) All Relevant Project Correspondence; xxx 5) Additional Information Sheets As Necessary Address Of Owner/Agent/Agency To Whom SHPO Comment Should Be Mailed: Greenberg Farrow Architecture, Inc. 21 South Evergreen Avenue, Suite 200 Arlington Heights, Illinois 60005 Contact Person: Ms. Marisa Kolman Phone Number:(847) 788-9200 Reviewers Comments: _________________________________________________________________________________________________ _________________________________________________________________________________________________ _________________________________________________________________________________________________ _________________________________________________________________________________________________ 11/03/93 (41 $A.85/ '1>B5/1 >/4-1;8;3E >/45@1/@A>1 $>;3>-9 ;2 @41 ):5B1>?5@E ;2 885:;5? -@ )>.-:- 4-9<-53: C-? /;:@-/@10 .E >11:.1>3 ->>;C >/45@1/@A>1 :/@; /;:0A/@ - /A8@A>-8 >1?;A>/1 >1/;::-5??-:/1?A>B1E;2-<>;<;?10 41/@->1 -/>1?;8->1:1>3E->>-E@;.18;/-@10;:11/41> &;-0>;A348E 91@1>?:;>@4;2-D;:&;-0:1->+;>7B5881 885:;5?53A>1 (41;.61/@5B1;2@41 ?A>B1EC-?@;A@585F1?@-:0->0->/4-1;8;35/-8?A>B1E@1/4:5=A1?@;5:B1:@;>E/A8@A>-8>1?;A>/1?-@@41 <>;<;?10 <>;61/@ 8;/-@5;: $>;61/@ 5:B1?@53-@5;:? 5:/8A010 ?@-:0->0 .-/73>;A:0 >1?1->/4 5:/8A05:3 885:;5?'@-@1 5?@;>5/$>1?1>B-@5;:#225/1G?&1B51C-:0;9<85-:/11@1>95:-@5;:?;28535.585@E 5?@ 885:;5? 5?@;>5/$>1?1>B-@5;:#225/1G?"-@5;:-8&135?@1>$;?5@5B1$>18595:->E#<5:5;: 5?@"-@5;:-8$->7 '1>B5/1 - .'/4C139-: -25180?A>B1E-:0<>1<->-@5;:;2@45?>1<;>@ >1B51C;2@41 885:;5? :B1:@;>E;2>/4-1;8;35/-8'5@1?9-5:@-5:10.E@41 885:;5?'@-@1!A?1A9-:0 4;?@10.E@41 885:;5?1<->@91:@;2"-@A>-8&1?;A>/1?2;A:0@4-@@41<>;61/@->1-4-?:;@.11:<>1B5;A?8E >1<;>@10-??A>B1E10.A@;:1?5@1 4-?.11:>1/;>010C5@45:@41<>;61/@8595@?'5@1 C-?>1/;>010;:@41.-?5?;2-8-:0;C:1>5:@1>B51C@4-@5:05/-@10@41>1C-?-?@>A/@A>15:@4-@8;/-@5;: 53A>1 -@;:1@591.A@5@9-E4-B1.11:9;B10:1D-95:-@5;:;2@4145?@;>5/-80;/A91:@?;:@41 885:;5?$A.85/;9-5: -:0(>-/@'-81?0-@-.-?15:05/-@1?@4-@@41;>535:-88-:0<A>/4-?1?;2@41<>;61/@ ->1-C1>1@; ?--/>59C;;0;: A3A?@ -:0A>@5??11/41>;: ";B19.1> 885:;5? '@-@1>/45B1? -(41 ):5@10'@-@1?1:1>-8 -:0#225/1?A>B1E<8-@2;>(;C:?45< ";>@4 -:0&-:31 -?@53A>1 5:05/-@1?@4-@@41<>;61/@->1-C-?<>-5>51/;B1>10C5@4;A@1:/8;?A>1?;> 59<>;B191:@? 885:;5? '@-@1 >/45B1? . 5?@;>5/ <8-@ 9-<? ;2 @41 ->1- 53A>1 01<5/@ :; >1?501:@5-8?@>A/@A>1?5:@41<>;61/@->1-1::1@@!/*5885-9? #381 *->:1> 5335:? 11>? (4145?@;>5/>1/;>0??A331?@@4-@@41<>;61/@->1-4-?.11:A?10<>59->58E2;>-3>5/A8@A>-8 <A>?A5@??5:/1A>;91>5/-:?1@@8191:@;2@41->1-5:@41950081:5:1@11:@4/1:@A>E 51805:B1?@53-@5;:;2@41 41/@->1 -/>1<>;61/@->1-C-?A:01>@-71:;: A8E (41 ?A>B1E->1-5?8;/-@10;:11/41>&;-0>;A348E 91@1>?:;>@4;2-D;:&;-0:1->+;>7B5881 885:;5? (41<>;61/@->1-5?.;A:010@;@41C1?@.E11/41>&;-0@;@41:;>@4.E-3>5/A8@A>-825180?@;@411-?@.E &;.&;E>117-:0@;@41?;A@4.E->-58>;-0>534@;2C-E53A>1 (41<>;61/@->1-/;:?5?@10;2 -3>5/A8@A>-825180?21-@A>5:3<8-:@10-:03>;C5:3/;>:C5@4 <1>/1:@3>;A:0?A>2-/1B5?5.585@E(41 <>;61/@->1-C-?5:B1?@53-@10A?5:3<101?@>5-:>1/;::-5??-:/1-@91@1>5:@1>B-8?";?@>A/@A>1?C1>1 <>1?1:@C5@45:@41<>;61/@8595@?";1B501:/12;> C-?8;/-@10(41251805:B1?@53-@5;:?8;/-@10 ;:1:1C->/4-1;8;35/-8?5@1 '5@1 5?8;/-@10 91@1>?:;>@4;2-D;:&;-0-:0 91@1>?1-?@;211/41>&;-0;:-28-@ A<8-:0->1-53A>1 (41?5@11D@1:0? 91@1>?:;>@4@;?;A@4.E 91@1>?1-?@@;C1?@-@-:181B-@5;: ;2 91@1>?-.;B1?1-81B18C5@45:-:-3>5/A8@A>-825180C5@4 <1>/1:@?A>2-/1B5?5.585@E53A>1 ';58? 9-<<10 -@ @45? 8;/-@5;: ->1 ';9;:-A7 ?58@ 8;-9 @; <1>/1:@ ?8;<1? "-@A>-8 &1?;A>/1? ;:?1>B-@5;:'1>B5/1? -';9;:-A7?;58?/;:?5?@;29;01>-@18EC1880>-5:10?;58?2;>910;:?@>1-9 @1>>-/1?-:0;A@C-?4<8-5:?A:01>95D104->0C;;02;>1?@(45??;58@E<1A?A-88E21-@A>1?- /1:@591@1> <4;>5F;:;20->73>-E5?4.>;C: +& ?58@8;-9A:01>8-5:.E- /1:@591@1>@45/74;>5F;:;2 0->73>-E5?4.>;C: +& ?58@8;-9;B1>.>;C: +& ?58@E/8-E8;-9@ 4;>5F;:"-@A>-8 &1?;A>/1?;:?1>B-@5;:'1>B5/1? .>1<>1?1:@-@5B1@4>11;2?5D?A>2-/1/;881/@5;:>1/;B1>10;:1 /;>1;:1@1>@5->E/41>@28-71-:0;:1.52-/12>-391:@?4;B18@1?@2;A:0- /1:@591@1><4;>5F;:;2 0->7E188;C5?4.>;C:?58@E/8-E;B1>-E188;C5?4.>;C: +&?58@E/8-E(41<>;25810;/A91:@?@41 ->1--?A:01>3;5:31>;?5;:(41?5@12A:/@5;:5:/8A01?85@45/<>;/1??5:3 :?A99->E 5?- 8595@10-/@5B5@E8;/-@5;:2>;9-:A:7:;C:<>145?@;>5/@591<1>5;0 (41 "-@5;:-8 &135?@1> ;2 5?@;>5/ $8-/1? "& $ 4-? 2;A> />5@1>5- .E C45/4 45?@;>5/ ?@>A/@A>1? -:0 ->/4-1;8;35/-8?5@1?9A?@.11B-8A-@105:;>01>@;01@1>95:1@415>18535.585@E2;>85?@5:3@41>15:$>;<1>@51? 9-E .1 18535.81 2;> @41 "-@5;:-8 &135?@1> 52 @41E ->1 -??;/5-@10 C5@4 1B1:@? @4-@ 4-B1 9-01 - ?53:525/-:@ /;:@>5.A@5;: @; @41 .>;-0 <-@@1>: ;2 45?@;>E ->1 -??;/5-@10 C5@4 @41 85B1? ;2 <1>?;:? ?53:525/-:@ @; ;A> <-?@ 19.;0E @41 05?@5:/@5B1 /4->-/@1>5?@5/? ;2 - @E<1 <1>5;0 ;> 91@4;0 ;2 /;:?@>A/@5;:;>@4-@>1<>1?1:@@41C;>7;2-9-?@1>;>@4-@<;??1??4534->@5?@5/B-8A1?;>@4-@>1<>1?1:@- ?53:525/-:@-:005?@5:3A5?4-.811:@5@EC4;?1/;9<;:1:@?9-E8-/75:05B50A-805?@5:/@5;:-:04-B1 E518010;>->185718E@;E51805:2;>9-@5;:59<;>@-:@5:<>145?@;>E;>45?@;>E(41 41/@->1 -/>1 <>;61/@->1-4-?@C;?5@1?-:0:;?@>A/@A>1?@;1B-8A-@1-3-5:?@@41"& $/>5@1>5- '5@1 4-?:1B1>.11:25180B1>52510-:05?>1<;>@10.E-8-:0;C:1>-?@418;/-@5;:;2-?@>A/@A>1 C41>1-2;A:0-@5;:C-?B5?5.81.A@@41?@>A/@A>19-E4-B1.11:9;B10(41 ?A>B1E;2@41->1- 2;A:0 @41 8;/-@5;: @; .1 -: -/@5B1 -3>5/A8@A>-8 25180 C5@4 :; 1B501:/1 @; 5:05/-@1 15@41> - ?@>A/@A>1 2;A:0-@5;: ;> @41 <>1?1:/1 ;2 /A8@A>-8 9-@1>5-8? (41?1 ;.?1>B-@5;:? 5:05/-@1 @41 ->1- 4-? .11: 91/4-:5/-88E-8@1>10@;-88;C2->95:385718E>19;B5:301<;?5@5;:-85:@13>5@E-?10;:@41-.?1:/1;2 /A8@A>-89-@1>5-8-:0@415:@1><>1@-@5;:;2-8;??;201<;?5@5;:-85:@13>5@E 5?>1/;991:010-? *.'&$& '"2;>85?@5:3;:@41"& $ '5@1 5?-8595@10-/@5B5@E8;/-@5;:2>;9-:A:7:;C:<>145?@;>5/@591<1>5;0(41?;58?5:05/-@1 @41->1-C-?85718E-2;>1?@5:-31:1>-88E:;:01<;?5@5;:-8?1@@5:35B1:@418595@10-9;A:@;29-@1>5-8? 8;/-@10A:01>4534B5?5.585@E/;:05@5;:? @411B501:/12;>?;581>;?5;: -:0@41-.?1:/1;205-3:;?@5/ 9-@1>5-8?@41>1-<<1->?@;.185@@81<;@1:@5-8@;-00>1??>1?1->/4=A1?@5;:?>1?A8@5:35:->1/;991:010 25:05:3;2*.'&$& '"2;>85?@5:3;:@41"& $(45?>1/;991:0-@5;:5?.-?10;:@418595@10/A8@A>-8 1B501:/1>1?A8@5:35:-8;C<;@1:@5-8@;-00>1???53:525/-:@>1?1->/4=A1?@5;:? (41 $A.85/ '1>B5/1 >/4-1;8;3E >/45@1/@A>1 $>;3>-9 /;:0A/@10-$4-?1 ->/4-1;8;35/-8 >1/;::-5??-:/1;2- 41/@->1 -/>1->1-2;>-<>;<;?10?;8->1:1>3E->>-E2-/585@E@;.18;/-@10 :1-> +;>7B5881 5: 1:0-88 ;A:@E 885:;5? (41 5:B1?@53-@5;:?A:01>@-71: C1>1 01?53:10 @; 501:@52E /A8@A>-8>1?;A>/1?-:0@;01@1>95:152<;??5.81>1?;A>/118535.585@E2;>85?@5:3;:@41"-@5;:-8&135?@1>;2 5?@;>5/$8-/1?"& $@41/>5@1>5-2;>C45/4->101?/>5.105: & (415:B1?@53-@5;:?501:@52510 ;:1<>1B5;A?8E>1/;>010-:0;:1:1C8E0125:10->/4-1;8;35/-8?5@1C5@4->1/;991:01025:05:3@4-@.;@4 ->1*.'&$& '"-:0:;?@>A/@A>1?C5@45:@41<>;61/@->1-?->1?A8@-25:05:3;2*&-.*,& ,*+",.&"- 5?9-012;>@45?<>;61/@-?10;:@45?25:05:35@5?>1/;991:010@4-@@41<>;61/@.1/81->102;>/A8@A>-8 >1?;A>/1/;:/1>:? 6HUYLFH/D\HU&UHGLWV &RS\ULJKW 1DWLRQDO*HRJUDSKLF6RFLHW\LFXEHG .LORPHWHUV 0LOHV/RFDWLRQ <25.9,//(48$'5$1*/( .(1'$//&2817<,//,12,6 0,187(6(5,(6 7232*5$3+,& .( .( Figure 1. Location of project area. 3URMHFW$UHD 6LWH/RFDWLRQ 3UHYLRXVO\5HFRUGHG6LWH/RFDWLRQ .(< 35(9,286/< 5(&25'(' Figure 2. Portions of the 1842 United States General Land Office survey plat, 1859, 1870 and 1903 maps of Kendall County, Illinois. 3URMHFW$UHD 6HUYLFH/D\HU&UHGLWV (VUL+(5(*DUPLQ F 2SHQ6WUHHW0DSFRQWULEXWRUV 0HWHUV )HHW Figure 3. erial photo and sketch map of pro ect area. &RUQ)LHOG 'UDLQDJH5DLOURDG $HULDO3KRWRJUDSK2EWDLQHGIURP(65,:RUOG,PDJHU\-XO\ %HHFKHU5RDG3ODQR,OOLQRLV .( /RFDWLRQ .( 35(9,286/< 5(&25'(' 3URMHFW$UHD 6LWH/RFDWLRQ 3UHYLRXVO\5HFRUGHG6LWH/RFDWLRQ .(< CITED SOURCES 1::1@@ -:0 !/*5885-9? +*#")! ''*/).2''&)*&- 1::1@@-:0 !/*5885-9?+;>7B5881 885:;5? 1;>31#381-:0;9<-:E . )! ,!.' -*#")! ''*/).2''&)*&-1;>31#381-:0;9<-:E45/-3; 885:;5? 885:;5?"-@5;:-8&135?@1>$;?5@5B1$>18595:->E#<5:5;: 5?@-//1??10 A:1 885:;5?&1B51C-:0;9<85-:/11@1>95:-@5;:?;28535.585@E 5?@-//1??10 A:1 885:;5?'@-@1>/45B1? - ''&)*&- / '& *( &) )! , . '"- 81/@>;:5/ ;/A91:@ 885:;5? '@-@1 >/45B1? 4@@<CCC?;??@-@158A?01<->@91:@?->/45B1?0-@-,8-:4@98-//1??10 A:1 . "!", ' *1)-%&+ ' .- *# ''&)*&- 885:;5? '@-@1 >/45B1? #: 2581 $A.85/ '1>B5/1>/4-1;8;3E>/45@1/@A>1$>;3>-9)>.-:- 885:;5? 885:;5?'@-@1!A?1A9 885:;5? :B1:@;>E;2>/4-1;8;35/-8'5@1?'<>5:325180 "-@5;:-8$->7'1>B5/1 - "-@5;:-8 5?@;>5/ -:09->7?$>;3>-9"-@5;:-8$->7'1>B5/1*-?45:3@;:81/@>;:5/ 0;/A91:@4@@<CCC/>:<?3;B:48-//1??10 A:1 . "-@5;:-8&135?@1>;2 5?@;>5/$8-/1?"-@5;:-8$->7'1>B5/1*-?45:3@;:81/@>;:5/ 0;/A91:@4@@<CCC/>:<?3;B:>8-//1??10 A:1 "-@A>-8&1?;A>/1?;:?1>B-@5;:'1>B5/1 - " *&'/,0"2';58'A>B1E'@-22"-@A>-8&1?;A>/1?;:?1>B-@5;:'1>B5/1):5@10'@-@1? 1<->@91:@;23>5/A8@A>181/@>;:5/0;/A91:@ 4@@<C1.?;58?A>B1E:>/?A0?0-3;B-<<*1.';58'A>B1E-?<D-//1??10 A:1 .##& & '*&'",&"-"- ,&+.&*)-';58'A>B1E'@-22"-@A>-8&1?;A>/1?;:?1>B-@5;:'1>B5/1 ):5@10'@-@1?1<->@91:@;23>5/A8@A>181/@>;:5/0;/A91:@ 4@@<;>@4;2@C:>/?A?0-3;B/35.5:;?0;?0:-91/35-//1??10 A:1 '/4C139-: ;4: *(+,"%")-&0"' )#*,.%"''&)*&- ./,","-",0"-2-."( ,. %" ./, '&0&-&*)- *#''&)*&- 885:;5?"-@A>1$>1?1>B1?'E?@19'<>5:325180 ):5@10'@-@1?1;8;35/-8'A>B1E +;>7B5881 G%A-0>-:381!-<):5@10'@-@1?1;8;35/-8'A>B1E*-?45:3@;: *->:1> 5335:?11>? .' -*#")! ''*/).2''&)*&-*->:1> 5335:?11>?45/-3; 885:;5? ILLINOIS ARCHAEOLOGICAL SITE RECORDING FORM ,OOLQRLV $UFKDHRORJLFDO 6LWH 5HFRUGLQJ )RUP 0HULGLDQ 5DQJH &RXQW\ )LHOG 1R 2ZQHUVKLS :*6 /DWLWXGH /RQJLWXGH 7RZQVKLS (19,5210(17 7RSRJUDSK\ 1HDUHVW:DWHU6XSSO\ 6RLO$VVRFLDWLRQ 'HVFULSWLRQ 6859(< 3URMHFW1DPH *URXQG&RYHU 3URMHFW7\SH 6XUIDFH9LVLELOLW\ 6XUYH\0HWKRGV 6LWH7\SH 6WDQGLQJ6WUXFWXUH 6,7(&21',7,21 ([WHQWRI'DPDJH 0DLQ&DXVHRI'DPDJH 0$7(5,$/62%6(59(' 1XPEHURI+LVWRULF$UWLIDFWV FRXQWRUHVWLPDWH 1XPEHURI3UHKLVWRULF$UWLIDFWV FRXQWRUHVWLPDWH 3UHKLVWRULF'LDJQRVWLF$UWLIDFWV 3UHKLVWRULF6XUIDFH)HDWXUHV 3UHKLVWRULF%XULHG)HDWXUHV $YH 'HSWK FP 'HVFULSWLRQ 7(0325$/$)),/,$7,21 3UHKLVWRULF8QNQRZQ :RRGODQG )URQWLHU$QWHEHOOXP $SULO 3DOHRLQGLDQ (DUO\:RRGODQG &LYLO:DU $SULO$SULO $UFKDLF 0LGGOH:RRGODQG )URQWLHU3RVW&LYLO:DU $SULO (DUO\$UFKDLF /DWH:RRGODQG (DUO\,QGXVWULDO 0LGGOH$UFKDLF 0LVVLVVLSSLDQ 8UEDQ,QGXVWULDO /DWH$UFKDLF 8SSHU0LVVLVVLSSLDQ 3URWRKLVWRULF +LVWRULF1DWLYH $PHULFDQ +LVWRULF JHQHULF &RORQLDO 3LRQHHU )URQWLHU JHQHULF 3RVW:DU SUHVHQW 'HVFULSWLRQ ,QVWLWXWLRQ 6XUYH\'DWH 5HSRUW'DWH,QVWLWXWLRQ 6+32 VW 6XUYH\ 'RF 1R 6XUYH\RU )RUP %\ 6+32 /RJ 1R &RPSOLDQFH6WDWXV &XUDWLRQ)DFLOLW\ +LVWRULF'LDJQRVWLF$UWLIDFWV +LVWRULF6XUIDFH)HDWXUHV +LVWRULF%XULHG)HDWXUHV $YH 'HSWK FP 6LWH1DPH 4XDGUDQJOH 6HFWLRQ .QRZQ$OWHUQDWH1DPHV 6LWH$UHD VTP (OHYDWLRQ PHWHUV$06/ 'UDLQDJH%DVLQ 5HYLVLW &RXQW\6LWH1R 5HFRUGHG +653$ 15+3/LVWLQJ 8SGDWHG 6XUYH\6DPSOLQJ6WUDWHJ\ Kendall Y 22-051: 11KE115 Yorkville 115 Private 3 37 N 7 E 17 2022.07.27 41.679561 -88.467107 2,267 Other Upland Lower Fox Rob Roy Creek 195 Plano-Elburn-Drummer (s2247) The site is reported 680 meters north of Faxon Road and 400 meters east of Beecher Road. The site is mapped as extending 60 meters north to south by 60 meters east to west. No evidence located in 2022 that site was present in this location. 22-051 Phase I CRM Cultivated 50 Pedestrian Unknown N Unknown Agriculture Total Observation 0 0 N N N N N 0 N 0 No surface materials were observed in 2022 during a survey of the site. No materials observed in 2022. G. Walz PSA 2022.07.11 N/A K. McGowan PSA 2022.07.27 N N 6HUYLFH/D\HU&UHGLWV &RS\ULJKW 1DWLRQDO*HRJUDSKLF6RFLHW\LFXEHG .LORPHWHUV 0LOHV/RFDWLRQ <25.9,//(48$'5$1*/( .(1'$//&2817<,//,12,6 0,187(6(5,(6 7232*5$3+,& .( 3URMHFW$UHD 3UHYLRXVO\5HFRUGHG6LWH/RFDWLRQ .(< 35(9,286/< 5(&25'(' ,OOLQRLV $UFKDHRORJLFDO 6LWH 5HFRUGLQJ )RUP 0HULGLDQ 5DQJH &RXQW\ )LHOG 1R 2ZQHUVKLS :*6 /DWLWXGH /RQJLWXGH 7RZQVKLS (19,5210(17 7RSRJUDSK\ 1HDUHVW:DWHU6XSSO\ 6RLO$VVRFLDWLRQ 'HVFULSWLRQ 6859(< 3URMHFW1DPH *URXQG&RYHU 3URMHFW7\SH 6XUIDFH9LVLELOLW\ 6XUYH\0HWKRGV 6LWH7\SH 6WDQGLQJ6WUXFWXUH 6,7(&21',7,21 ([WHQWRI'DPDJH 0DLQ&DXVHRI'DPDJH 0$7(5,$/62%6(59(' 1XPEHURI+LVWRULF$UWLIDFWV FRXQWRUHVWLPDWH 1XPEHURI3UHKLVWRULF$UWLIDFWV FRXQWRUHVWLPDWH 3UHKLVWRULF'LDJQRVWLF$UWLIDFWV 3UHKLVWRULF6XUIDFH)HDWXUHV 3UHKLVWRULF%XULHG)HDWXUHV $YH 'HSWK FP 'HVFULSWLRQ 7(0325$/$)),/,$7,21 3UHKLVWRULF8QNQRZQ :RRGODQG )URQWLHU$QWHEHOOXP $SULO 3DOHRLQGLDQ (DUO\:RRGODQG &LYLO:DU $SULO$SULO $UFKDLF 0LGGOH:RRGODQG )URQWLHU3RVW&LYLO:DU $SULO (DUO\$UFKDLF /DWH:RRGODQG (DUO\,QGXVWULDO 0LGGOH$UFKDLF 0LVVLVVLSSLDQ 8UEDQ,QGXVWULDO /DWH$UFKDLF 8SSHU0LVVLVVLSSLDQ 3URWRKLVWRULF +LVWRULF1DWLYH $PHULFDQ +LVWRULF JHQHULF &RORQLDO 3LRQHHU )URQWLHU JHQHULF 3RVW:DU SUHVHQW 'HVFULSWLRQ ,QVWLWXWLRQ 6XUYH\'DWH 5HSRUW'DWH,QVWLWXWLRQ 6+32 VW 6XUYH\ 'RF 1R 6XUYH\RU )RUP %\ 6+32 /RJ 1R &RPSOLDQFH6WDWXV &XUDWLRQ)DFLOLW\ +LVWRULF'LDJQRVWLF$UWLIDFWV +LVWRULF6XUIDFH)HDWXUHV +LVWRULF%XULHG)HDWXUHV $YH 'HSWK FP 6LWH1DPH 4XDGUDQJOH 6HFWLRQ .QRZQ$OWHUQDWH1DPHV 6LWH$UHD VTP (OHYDWLRQ PHWHUV$06/ 'UDLQDJH%DVLQ 5HYLVLW &RXQW\6LWH1R 5HFRUGHG +653$ 15+3/LVWLQJ 8SGDWHG 6XUYH\6DPSOLQJ6WUDWHJ\ Kendall N 22-051: AOS 101 Yorkville 1404 Private 3 37 N 7 E 18 2022.07.27 41.679290 -88.471298 481 Other Upland Lower Fox Rob Roy Creek 195 Plano-Elburn-Drummer (s2247) Site is located 600 meters north of Faxon Road and 60 meters east of Beecher Road in a glacially formed upland area. The site extends 20 meters north to south by 30 meters east to west in an agricultural field. 22-051 Phase I CRM Cultivated 50 Pedestrian Shovel Test Unknown N Moderate Agriculture Representative Sample Collection 3 0 N N N N N 0 N 0 The representative collection recovered one core, one tertiary chert flake, and one biface fragment. Y The recovered assemblage lacks attributes diagnostic of a specific temporal period or cultural phase. G. Walz PSA 2022.07.11 N/A K. McGowan PSA 2022.07.27 N N 6HUYLFH/D\HU&UHGLWV (VUL+(5(*DUPLQ F 2SHQ6WUHHW0DSFRQWULEXWRUV 0HWHUV )HHW &RUQ)LHOG 'UDLQDJH5DLOURDG $HULDO3KRWRJUDSK2EWDLQHGIURP(65,:RUOG,PDJHU\-XO\ %HHFKHU5RDG3ODQR,OOLQRLV .( /RFDWLRQ 3URMHFW$UHD 6LWH/RFDWLRQ .(< 6HUYLFH/D\HU&UHGLWV &RS\ULJKW 1DWLRQDO*HRJUDSKLF6RFLHW\LFXEHG .LORPHWHUV 0LOHV/RFDWLRQ <25.9,//(48$'5$1*/( .(1'$//&2817<,//,12,6 0,187(6(5,(6 7232*5$3+,& .( 3URMHFW$UHD 6LWH/RFDWLRQ .(< dŽǁŚŽŵŝƚŵĂLJĐŽŶĐĞƌŶ͗ /͕ZŽďĞƌƚ>ŽĨƚƵƐĂŵĂǁĂƌĞŽĨƚŚĞƐŽůĂƌƉƌŽũĞĐƚƚŚĂƚEĞǁ>ĞĂĨ ŶĞƌŐLJŝƐƉƌŽƉŽƐŝŶŐ ĂŶĚĂƌĞŝŶĨƵůůƐƵƉƉŽƌƚŽĨƚŚĞŵĂƉƉůLJŝŶŐĨŽƌƚŚĞƉĞƌŵŝƚ͘ dŚĂŶŬLJŽƵ ZŽďĞƌƚĂŶĚ/ůĚĞĨŽŶƐĂ>ŽĨƚƵƐ ϭϭϭϱϵ&ĂdžŽŶZŽĂĚ zŽƌŬǀŝůůĞ͕/>͘ϲϬϱϲϬ 8875F;H73F7 #73E7A??7@57?7@F 3F7 0 1 #7EEAD(A47DF$ >678A@E3#A8FGE#;H;@9*DGEF #7EE77 )&#( , #&'$ %*## 'DAB7DFK66D7EE775:7D(A36/AD=H;>>7 # ' % &BF;A@'3K?7@F ;DEF66;F;A@3>&BF;A@ '3K?7@F )75A@666;F;A@3> &BF;A@'3K?7@F (7@F #73E7*7D?*:7F7D?5A??7@5;@9A@F:763F7A867>;H7DKA8F:7 J7D5;E7%AF;573@6 7@6;@9A@F:7 JB;D3F;A@3F7EG4<75FFA#7EE77PEABF;A@FA7JF7@6F:7 #73E7*7D?8ADGBFA8AGD366;F;A@3>3@6EG557EE;H7B7D;A6EA88;H7 K73DE735: JB;D3F;A@3F7*:763F7F:3F;EFI7@FK K73DE8DA?F:7A??7D5;3>&B7D3F;A@3F7 3E?3K477JF7@676BGDEG3@FFAF:;E9D77?7@F 66D7EE7E8AD%AF;57E#7EE77 )&#( , #&'$ %* ## 5 AADD79A)A>3D)KEF7?E @5 *75:@A>A9KD;H7)G;F7 #AI7>>$ FF@ ,''DA<75F ;@3@57 -;F:35ABKFA ADD79A)A>3D)KEF7?E @5 D3@=>;@)FD77F)G;F7 &3=>3@6 FF@ 7@7D3>AG@E7> -;F:35ABKFA >793>@AF;57E4ADD79AEA>3D 5A? #7EEAD (& (*$ # &%) #& *+)# , % *(+)* 3JA@(A36 /AD=H;>>7 # FF@(A47DF#A8FGE 'RFX6LJQ(QYHORSH,' )( % %$))&' ' *:;E&BF;A@3@6#73E79D77?7@FF:;EM * & ',N;E63F763EA8F:7 8875F;H73F73@6;E 7@F7D76;@FA4K3@647FI77@#7EEAD3@6#7EE77735:3M*,1N3@6FA97F:7DF:7M*," +N #7EEADAI@EF:7D73>BDAB7DFKFA97F:7DI;F:3@KD;9:FE47@78;FE3@673E7?7@FE3BBGDF7@3@F FAEG5:D73>BDAB7DFK?AD7B3DF;5G>3D>K67E5D;476;@F:73FF35:76=-.'.9 F:7M*() *,1N #7EE7767E;D7EFAA4F3;@F:77J5>GE;H7D;9:FFAA55GBK3>>AD3BADF;A@A8F:7'DAB7DFKF:7 M' N3@6;83BB>;534>7F:7 3E7?7@FEF:7 3E7?7@FEFA97F:7DI;F:F:7#3@63D75A>>75F;H7>KD787DD76 FA3EF:7M* &"+ +N?AD7B3DF;5G>3D>K67E5D;476;@F:73FF35:76=-.'.9 3@6FA7@<AK3>>F:7D;9:FE @757EE3DK 8AD #7EE77 FA A55GBK 67H7>AB 67E;9@ 7@9;@77D 3557EE 5A@EFDG5F ?A@;FAD ;@EF3>> AI@ ?3;@F3;@3@6AB7D3F7A@7AD?AD7EA>3DB:AFAHA>F3;57>75FD;5BAI7D97@7D3F;@93@6 AD7@7D9KEFAD397 )KEF7?E3E678;@76;@ J:;4;F3FF35:76:7D7FA3EI7>>3E3@5;>>3DK4G;>6;@9EEFDG5FGD7E8;JFGD7EAD 7@5>AEGD7E@757EE3DKAD67E;D34>7;@5A@@75F;A@F:7D7I;F:FA47>A53F76GBA@G@67DA@3@6I;F:;@F:7 'D7?;E7EAD3@KBADF;A@F:7D7A83@63>>D;9:FE@757EE3DKAD67E;D34>78AD#7EE77FAE7>>F:77@7D9K97@7D3F76 4KEFAD76I;F:;@3@6 AD;@<75F764KEG5:)KEF7?3@63@K3@63>>AF:7D5D76;FEEA>3DD7@7I34>77@7D9K 5D76;FE3@63@KAF:7D7@H;DA@?7@F3>8;@3@5;3>3FFD;4GF7E5D73F763E3D7EG>FA8EG5:7@7D9K97@7D3F;A@3@6 AD EFAD397 %&-* ( &( ;@5A@E;67D3F;A@A8F:78AD79A;@93@6F:7?GFG3>5AH7@3@FE3@639D77?7@FE :7D7;@5A@F3;@76F:7D757;BF3@6EG88;5;7@5KA8I:;5:3D735=@AI>76976#7EE773@6#7EEAD:7D74K39D77 FA3@6;@F7@6FA474AG@64KF:78AD79A;@9D75;F3>E3@63E8A>>AIE *+.3.9.438 3B;F3>;L76F7D?EGE764GF@AFAF:7DI;E7678;@76;@F:;E9D77?7@F:3H7F:7 ?73@;@9E3EE;9@76FAF:7?A@F:7AH7D):77FAD;@F:73FF35:76=-.'.9 ((*8894745*79> A??7@5;@9A@F:7 8875F;H73F73@6F:DAG9:AGFF:7&BF;A@*7D? #7EE773@6;FE7?B>AK77E397@FE5A@FD35FADE3@65GDD7@FADBAF7@F;3>>7@67DEAD;@H7EFADEE:3>>:3H7F:7 D;9:FFA7@F7DGBA@F:7'DAB7DFKFAB7D8AD?3>>788ADF3@6>34AD@757EE3DKFA53DDKAGFF7EFE;@EB75F;A@E EGDH7KE3@6;@H7EF;93F;A@EF:3F#7EE77677?E@757EE3DKAD36H;E34>7FA3EE7EEF:7873E;4;>;FKA8F:7'DAB7DFK 8ADF:75A@EFDG5F;A@3@6AB7D3F;A@A8F:7)KEF7?M +,+N GD;@9F:7#73E7*7D?#7EE77E:3>>:3H7 7J5>GE;H73557EEFAF:7#3@63@6@A@7J5>GE;H73557EEFAF:7 3E7?7@FEFA67E;9@7@9;@77D5A@EFDG5F ;@EF3>>;@EB75FF7EFAB7D3F7GB9D367D7B3;D3@6?3;@F3;@F:7)KEF7? #7EEADE:3>>@AF;@F7D87D7I;F:F:7 *7EFE6GD;@9F:7&BF;A@*7D?3@66GD;@9F:7#73E7*7D?#7EEADE:3>>@AF7@F7DA@F:7#3@6AD;@F7D87D7 I;F:F:7;@EF3>>3F;A@A8F:7)KEF7??AH736<GEF3>F7DF3?B7DI;F:ADAF:7DI;E7:3@6>73@K#7EE77 7CG;B?7@FAD3@K5A?BA@7@FA8F:7)KEF7? *7EFEE:3>>;@5>G67;67@F;8;53F;A@A83>>G@67D9DAG@66D3;@F;>7E A@F:7'DAB7DFK 8#7EE7763?397E3@K6D3;@F;>76GD;@9F:75A@EFDG5F;A@AB7D3F;A@ADD7?AH3>A8F:7 )KEF7?#7EE77E:3>>7;F:7DD7B3;DEG5:6D3;@F;>7AD5A@EFDG5F3@7I6D3;@F;>73F#7EE77PEABF;A@ 59.4394*&8*9-*7*2.8*8 3 D3@FA8&BF;A@ #7EEAD:7D74K9D3@FEFA#7EE77F:77J5>GE;H7ABF;A@FA>73E73>> AD3BADF;A@A8F:7#3@63@635CG;D7F:7 3E7?7@FEA@F:7F7D?E3@65A@6;F;A@EE7F8ADF:;@F:;E9D77?7@F F:7M),"('N 4*;?73@6$3@@7DA8 J7D5;E7A8F:7&BF;A@ *:7&BF;A@E:3>>478AD3@;@;F;3> F7D?A88;H7:G@6D768ADFK 63KE38F7DF:7 8875F;H73F73E;F?3K477JF7@676F:7M),"(' *&N *:7&BF;A@*7D??3K477JF7@6764K#7EE778ADGBFAFIA 366;F;A@3>F:D77:G@6D76E;JFK8;H7 63KB7D;A6EGBA@@AF;57FA#7EEADBD;ADFAF:77@6A8F:7F:7@5GDD7@F&BF;A@*7D? 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 5 6 #7EEADAAB7D3F;A@ GD;@9F:7&BF;A@*7D?3@6F:DAG9:AGFF:7#73E7*7D? #7EEADE:3>>8G>>K5AAB7D3F7I;F:;F:7B7D8AD?3@57A8*7EFE3F#7EE77PE7JB7@E7;;F:7A4F3;@;@94K #7EE773F#7EE77PE7JB7@E7A83>>>;57@E7E3@6'7D?;FEAD3GF:AD;L3F;A@ED7CG;D768AD#7EE77PEGE7A8F:7 'D7?;E7E8DA?3>>3BB>;534>79AH7D@?7@F3@6 ADD79G>3FADK7@F;F;7E;@5>G6;@93@K3BBDAH3>ED7CG;D76FA A4F3;@3F3J343F7?7@F8ADF:7'D7?;E7E3E?3K473BB>;534>73@63@KEG46;H;E;A@A8F:7'DAB7DFKFA47 EAG9:F 4K #7EE77 ;@ 5A@@75F;A@ I;F: F:7 5A@EFDG5F;A@ AB7D3F;A@ 3@6 ?3;@F7@3@57 A8 F:7 )KEF7?E 5A>>75F;H7>KM (. *'& ',%))*(.%+N;;;F:7E75GD;@94K#7EE773F#7EE77PE7JB7@E7A83>>AF:7D >73E7E39D77?7@FE>;57@E7E3@6'7D?;FEAD3GF:AD;L3F;A@EF:3FD7>3F7FA7;F:7DF:7'DAB7DFKAD'D7?;E7E 3@6;HF:7E75GD;@94K#7EE77A83@K3?7@6?7@FEFAF:;E9D77?7@FF:3F3D7D73EA@34>K@757EE3DKFA 355A??A63F7 F:7 )KEF7? AD FA 835;>;F3F7 3@ 3EE;9@?7@F BGDEG3@F FA )75F;A@ #7EEAD 39D77E 3@6 35=@AI>7697EF:3F3@K3?7@6?7@FFAF:79D77?7@FBGDEG3@FFAF:;E)75F;A@6F:3F6A7E@AF?3F7D;3>>K ;@5D73E73@KA4>;93F;A@AD?3F7D;3>>K675D73E73@KD;9:FA8#7EEAD:7D7G@67DE:3>>@AFD7EG>F;@36<GEF?7@F A8F:7(7@FG@>7EEAF:7DI;E7D7CG;D76G@67DF:;E9D77?7@F #7EEAD3GF:AD;L7E#7EE773@6;FE88;>;3F7EFA 35F3E#7EEADPE397@F8ADEG4?;EE;A@A83BB>;53F;A@E3@6D7>3F76B>3@E6A5G?7@FE3@6D75AD6;@9E3@6FA 3BB73D 478AD7 4A3D6E 3@6 AF:7D A88;5;3>E I;F: D7EB75F FA A4F3;@;@9 3BBDAH3>E 8AD F:7 )KEF7?E FA 47 5A@EFDG5F76A@F:7'D7?;E7E3@6E:3>>7J75GF73@3GF:AD;L3F;A@>7FF7DFAF:3F78875FM-,!(*"2,"(' ,, *N ;@EG4EF3@F;3>>KF:78AD?;@F:73FF35:76=-.'.9 #7EEAD39D77EFAGE7D73EA@34>7788ADFE;@3EE;EF;@9 #7EE77FA35CG;D7@757EE3DKGF;>;FKE7DH;573FF:7'D7?;E7E @F:77H7@FF:3F3GF;>;FK5A?B3@KD7CG;D7E3@ 73E7?7@F;@5A@@75F;A@I;F:#7EE77PEGE7A8F:7'D7?;E7E6GD;@9F:7&BF;A@*7D?AD#73E7*7D?#7EEAD E:3>> 9D3@F EG5: @757EE3DK 73E7?7@F FA F:7 GF;>;FK 5A?B3@K BDAH;676 F:3F EG5: 73E7?7@F ;E ;@ 3 5A??7D5;3>>KD73EA@34>73@6D75AD634>78AD? 7 +E7A8F:7'DAB7DFK GD;@9F:7&BF;A@*7D?#7EEAD?3K5A@F;@G7FAGE7F:7 'DAB7DFK;@F:7AD6;@3DK5AGDE7 #7EEADE:3>>@AF5A??;FI3EF7A@F:7'DAB7DFKAD AF:7DI;E7?3F7D;3>>K5:3@97F:7'DAB7DFK@ADI;>>#7EEAD39D77FA9D3@FADB7D?;F3@K73E7?7@F>73E7 >;57@E7D;9:FA83557EEADAF:7D7@5G?4D3@57ADBAEE7EEADKD;9:F;@F:7'D7?;E7EFA3@KF:;D6B3DFKI;F:AGF F:7BD;ADID;FF7@5A@E7@FA8#7EE77 %AFI;F:EF3@6;@9F:78AD79A;@9;8#7EEAD>73E7EF:7'DAB7DFKFA3F:;D6 B3DFK6GD;@9F:7&BF;A@*7D?EG5:>73E7E:3>>47F7D?;@34>7GBA@F:;DFK 63KEP@AF;57EG5:F:3FGBA@ @AF;578DA?#7EE77F:3F;FI;>>7J7D5;E7F:7&BF;A@M* 0 * "+ (," N3@6 ADEF3DF5A@EFDG5F;A@#7EEAD E:3>>F7D?;@3F73@K>73E7A@F:7'DAB7DFK3@6EG5:F7D?;@3F;A@E:3>>4778875F;H7;@@A?AD7F:3@F:;DFK 63KE 85DABE:3H7477@B>3@F76A@F:7'DAB7DFK4K#7EEADAD#7EEADPEF7@3@F3@6EG5:5DABEI;>>@AF47 :3DH7EF76I;F:;@F:;DFK 63KEA8D757;H;@9F:7'D7 J7D5;E7%AF;57#7EE77E:3>>D7;?4GDE7#7EEADAD #7EEADPEF7@3@F8ADF:7H3>G7A8F:75DABE>A53F76I;F:;@F:7'D7?;E7EM*()(&) '+,"('N DAB A?B7@E3F;A@I;>>4753>5G>3F764K?G>F;B>K;@9F:735D7397A85DAB>3@6I;F:;@F:7'D7?;E7E4KF:7 3;D $3D=7F'D;57B7D35D7A8EG5:5DAB *:7 "**$ ,*" NE:3>>477CG3>FAF:73H7D397H3>G7A8F:7 3BB>;534>75DAB3EBDAH;6764KF:7+@;F76)F3F7E7B3DF?7@FA89D;5G>FGD7 DABA?B7@E3F;A@E:3>>47 BDAD3F768ADB3DF;3>35D7E38875F76 #7EE77I;>>?3=73@KDABA?B7@E3F;A@B3K?7@FFA#7EEADAD #7EEADPEF7@3@FI;F:;@F:;DFK 63KEA867>;H7DKA8F:7'D7 J7D5;E7%AF;57 =*7(.8*4+59.43 *&8* &8*2*398 &3)*1&9*).,-98 3 J7D5;E7A8&BF;A@ @AD67DFA7J7D5;E7F:7&BF;A@#7EE77?GEF67>;H7DFA#7EEAD 3@AF;57A87J7D5;E7F:7M 0 * "+ (," NBD;ADFAF:77JB;D3F;A@A8F:7&BF;A@*7D? *:763F7A8F:7 J7D5;E7%AF;57E:3>>47F:75A??7@57?7@FA8F:7#73E7*7D?F:7M + (&& ' & ',, N 4#73E7 )G4<75FFAD757;BFA8F:7 J7D5;E7%AF;57#7EEAD:7D74K>73E7E3@69D3@FE 'RFX6LJQ(QYHORSH,' )( % %$))&' ' FA#7EE778ADF:7#73E7*7D?F:77J5>GE;H7D;9:FEFAF:7#3@6FA97F:7DI;F:3>>D;9:FF;F>73@6;@F7D7EFA8 #7EEAD;@3@6FA3>>73E7?7@FED;9:FEBD;H;>797E3@63BBGDF7@3@57EFAF:7E3?747>A@9;@9AD;@3@KI3K 3BB7DF3;@;@9F:7D7FAFAA55GBK67H7>AB67E;9@7@9;@77D5A@EFDG5F3557EE?A@;FAD;@EF3>>AI@AB7D3F7 ?3;@F3;@D7B3;DD7B>357;?BDAH73@6D7?AH7F:7)KEF7?8ADF:797@7D3F;A@EFAD3973@66;EFD;4GF;A@A8 7>75FD;53>BAI7D 5 3E7?7@F )G4<75FFAD757;BFA8F:7 J7D5;E7%AF;573@6;8@AF76A@ J:;4;F #7EEAD:7D74K9D3@FEFA#7EE773@A@7J5>GE;H73BBGDF7@3@F73E7?7@FA@G@67DAH7D35DAEE3@6F:DAG9: F:7'DAB7DFK;@F:7>A53F;A@E?AD7B3DF;5G>3D>K67E5D;476A@F:73FF35:76=-.'.9 8ADF:7#73E7*7D?FA A55GBK 67H7>AB 67E;9@ 7@9;@77D 5A@EFDG5F 3557EE ?A@;FAD;@EF3>> AI@ AB7D3F7 ?3;@F3;@ D7B3;D D7B>357;?BDAH73@6D7?AH73F3>>F;?7EA@3 :AGDE363K63KE3I77=43E;E;3DA36M ++ + & ',N 3@6 ;; GF;>;FK 3@6 5A??G@;53F;A@ ;@8D3EFDG5FGD7 ;@5>G6;@9 I;F:AGF >;?;F3F;A@ BA>7E EGBBADF;@9 FAI7DE 9GKE 3@6 3@5:ADE 8;47DE 534>7E 3@6 AF:7D 5A@6G5FADE 3@6 5A@6G;FE 3@6 B36E FD3@E8AD?7DEEI;F5:7EH3G>FE3@6534;@7FE3@6D7>3F767CG;B?7@FFA5A@@75FF:7)KEF7?FAF:7>A53>7>75FD;5 6;EFD;4GF;A@EKEF7?FA97F:7DI;F:F:7D;9:FA83557EEFAF:7GF;>;FK;@8D3EFDG5FGD7AH7DF:7'DAB7DFK8AD3@K BGDBAE7D73EA@34>K5A@@75F76I;F:F:7)KEF7?F:7M,"%",1 + & ',N #7EEAD:7D74K3>EA9D3@FEFA #7EE773@6F:73BB>;534>7GF;>;FK5A?B3@K3F3>>F;?7EA@3 :AGDE363K63KE3I77=43E;E8ADF:7 #73E7*7D?3@73E7?7@F8AD;@9D7EE79D7EE3@6D7>3F76D;9:FEAH7DF:7'DAB7DFK3@6 AD3@KEGDDAG@6;@9AD @73D4KBDAB7DFKAI@76AD>73E764K#7EEADB3EE397F:DAG9:I:;5:;E@757EE3DKAD5A@H7@;7@FFA;@EF3>> AB7D3F7AD93;@3557EEFAF:7)KEF7?ADF:7'D7?;E7EF:7M + & ',N3@6FA97F:7DI;F:F:7557EE 3E7?7@F3@6F:7+F;>;FK 3E7?7@FF:7M + & ',+N 8#7EE7767F7D?;@7E;@;FED73EA@34>76;E5D7F;A@F:3F 3@K366;F;A@3>73E7?7@FE35DAEEF:7'DAB7DFK3D7@757EE3DKGE78G>AD3BBDABD;3F78ADF:75A@EFDG5F;A@3@6 AD AB7D3F;A@ A8 F:7 )KEF7? #7EEAD E:3>> 8G>>K 5AAB7D3F7 ;@ 9D3@F;@9 AD 39D77;@9 FA EG5: 73E7?7@FE 4K 3?7@6?7@FFAF:;E9D77?7@FAD4KE7B3D3F739D77?7@F3@6D75AD63F;A@A8E3?7 6A@EFDG5F;A@#3K6AI@D73 )G4<75FFAD757;BFA8F:7 J7D5;E7%AF;57#7EEAD :7D74K8GDF:7D9D3@FEFA#7EE773@6#7EE77:7D74K3557BFE8DA?#7EEAD3@A@7J5>GE;H7>;57@E7FAGE73@ 3D73A8F:7'DAB7DFK;@3>A53F;A@?GFG3>>K39D776GBA@4KF:7'3DF;7EF:7M('+,*- ,"('" '+ NI:;5: 3D73E:3>>47D787DD76FA:7D7;@3EF:7M('+,*- ,"('" '+ * N8ADGE73E3>3K6AI@3@65A@EFDG5F;A@ EF39;@93D733@68ADF7?BAD3DKEFAD397 )G5:A@EFDG5F;A@#;57@E7E:3>>5A??7@573FEG5:F;?73E#7EE77 5A??7@57E5A@EFDG5F;A@A8F:7)KEF7?3@6E:3>>F7D?;@3F7A@F:7A??7D5;3>&B7D3F;A@3F7 #7EE77E:3>> :3H73557EEFAF:7A@EFDG5F;A@#;57@E7D73 :AGDEB7D63K63KEB7DI77= #7EE7739D77EFAIAD=;@ 9AA683;F:I;F:#7EEADFA?;@;?;L73@K;@F7D87D7@57I;F:F:7AB7D3F;A@EA8#7EEADAD3@KAF:7D>7EE77EA@ F:7'DAB7DFK +BA@ADBD;ADFAF:7A??7D5;3>&B7D3F;A@3F7#7EE773F#7EE77PEEA>75AEF3@67JB7@E7 E:3>>EGDD7@67DF:7A@EFDG5F;A@#;57@E7D73FA#7EEAD;@F:7E3?75A@6;F;A@3EF:763F7#7EE778;DEF A55GB;76F:7A@EFDG5F;A@#;57@E7D73AD6;@3DKI73D3@6F73D7J57BF76 7#3@6E53B7#;57@E7 #7EEAD9D3@FEFA#7EE773>;57@E7FAGE73@63557EE#7EEADPE 'DAB7DFK8ADBGDBAE7EA8FD77FD;??;@95>73D;@9B>3@F;@9?3;@F7@3@573@6>3@6E53B;@93E?3K47D7CG;D76 4KF:;E9D77?7@FADF:73BB>;534>7?G@;5;B3>;FK;@I:;5:F:7'D7?;E7E;E>A53F76 *:;E>;57@E7E:3>>DG@ 8ADF:7*7D?A8F:;E9D77?7@F3@6E:3>>B7D?;F#7EE77FAB>3@F?3;@F3;@3@6FD;?FD77E3@6H797F3F;A@A@ 3@3E@7767643E;E3@6FA6AAF:7DEG5:F:;@9E3ED7CG;D768ADF:7EG557EE8G>AB7D3F;A@A8F:7)KEF7?EA@ F:7'D7?;E7E 8+F;>;F;7E F#7EE77PED7CG7EF3@67JB7@E7#7EEADE:3>>BDAH;67AD5AAB7D3F7I;F: F:7BDAH;E;A@A87>75FD;55GDD7@F3@6I3F7DFAF:7B7D;?7F7DA8F:7'D7?;E7E E7B3D3F7 ?7F7DE8ADEG5:GF;>;F;7EE:3>>47;@EF3>>763F#7EE77PE7JB7@E73@6#7EE77E:3>>47D7EBA@E;4>78AD3>>GF;>;FK 7JB7@E7E #7EEAD9D3@FE#7EE77F:7D;9:FFA;@EF3>>GE7?A6;8K3@6D7?AH7I3F7D>;@7EE7I7D>;@7EEFAD? I3F7D>;@7EAH7D:7363@6 ADG@67D9DAG@6BAI7D>;@7E8G7>>;@7EF7>7B:A@73@65A??G@;53F;A@>;@7E B;B7>;@7E5A@H7KADE3@66D3;@3976;F5:7E3@6 AD53@3>EKEF7?EI;F:;@F:7'D7?;E7E3E3D7D73EA@34>K D7CG;D768ADAB7D3F;A@A8F:7)KEF7?3@6GE7AD?A6;8KF:77J;EF;@9>;@7E6;F5:7E3@653@3>EKEF7?E3E ?3K47D73EA@34>KD7CG;D76EG4<75FFA#7EEADPEBD;AD5A@E7@FI:;5:E:3>>@AF47G@D73EA@34>K67>3K76 5A@6;F;A@76ADI;F::7>63@69;H7@I;F:;@F7@ 63KEA8@AF;8;53F;A@ADAF:7DI;E7677?763BBDAH76 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 9*:7 '3DF;7E D75A9@;L7 F:3F F:7 67E5D;BF;A@E A8 F:7 'D7?;E7E 3D7 43E76 A@ BD7>;?;@3DKE;F76;E5AH7DK;@8AD?3F;A@3@6F:3FF:7E767E5D;BF;A@EE:3>>47?A6;8;76H;33?7@6?7@FBD;AD FA5A@EFDG5F;A@ EEG5:#7EEAD:7D74K39D77EFA7J75GF73@K3?7@6?7@FFAF:;E9D77?7@FBDABAE764K #7EE77I:;5:?A6;8;7EF:7'D7?;E7E;@5>G6;@9D76G5;@9F:7E;L7A8F:7'D7?;E7E3@6 ADEB>;FF;@9F:7 'D7?;E7E;@FAFIAAD?AD7FA355A??A63F7FIAAD?AD7EKEF7?E3@67@F7D;@9;@FA?G>F;B>7>73E7EBDAH;676 F:3FEG5:3?7@6?7@F;ED73EA@34>K@757EE3DKFA355A??A63F7;F:7)KEF7?3E67E;9@76AD;;F:7)KEF7? 3E?A6;8;764K#7EE77FA5A?B>KI;F:F:7D7CG;D7?7@FEA83@K AH7D@?7@F3>GF:AD;FKADF:7#A53> >75FD;5 +F;>;FK;@5>G6;@94GF@AF>;?;F76FA7@F7D;@9;@FA3@3?7@6?7@F;@F:78AD?3FF35:76:7D7FA3E=-.'.9 ADF:73HA;63@57A86AG4FG@67D@A5;D5G?EF3@57EE:3>>#7EEAD477@F;F>76FA3@K;@5D73E7;@(7@FADAF:7D 366;F;A@3>5A?B7@E3F;A@G@67DF:;E9D77?7@F3E3D7EG>FA83@3?7@6?7@FFAF:767E5D;BF;A@A8F:7 'D7?;E7E *72&3) *72.3&9.43 *24;&1 3*:7#73E7*7D?E:3>>5A??7@57A@F:7#73E7A??7@57?7@F3F73@6F7D?;@3F7 A@F:7 JB;D3F;A@3F73E;F?3K477JF7@676G@>7EEAF:7DI;E7F7D?;@3F76BGDEG3@FFAF:;E9D77?7@F 4#7EE77E:3>>:3H7F:7D;9:F;@;FEEA>76;E5D7F;A@FAF7D?;@3F7F:;E9D77?7@F3F 3@KF;?7BD;ADFAF:7A??7D5;3>&B7D3F;A@3F7 5 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 6#7EE77E:3>>BDAH;67FA#7EEAD3675A??;EE;A@;@93@6D7?AH3>4A@6;@F:73?AG@F EG88;5;7@FFAB7D8AD?;FEA4>;93F;A@A8)KEF7?(7?AH3>BDAH;676:AI7H7D;8F:75AG@FK;@I:;5:F:7 'DAB7DFK;E>A53F76ADAF:7D9AH7D@?7@F3>397@5KE:3>>D7CG;D73675A??;EE;A@;@94A@6;@5A@@75F;A@I;F: F:7)KEF7?3M (. *'& ',% (&&"++"('"' (' %" ,"('NF:7@E3F;E835F;A@4K#7EE77A8EG5: AH7D@?7@F3>75A??;EE;A@;@9A@6&4>;93F;A@E:3>>47677?76FAE3F;E8K#7EE77PEA4>;93F;A@FABDAH;67 3675A??;EE;A@;@93@6D7?AH3>4A@63@6@A366;F;A@3>4A@6E:3>>47D7CG;D76:7D7G@67D =9*38.4359.43#7EE77E:3>>:3H7F:7ABF;A@FA7JF7@6F:7#73E7*7D?M 0, '+"(' ),"('N8ADGBFA8AGD366;F;A@3>3@6EG557EE;H7B7D;A6EA88;H7K73DE735:479;@@;@9A@F:763K 8A>>AI;@9F:7 JB;D3F;A@3F7A8F:7F:7@5GDD7@F#73E7*7D?735:3@M 0, '+"(' *&N4K9;H;@9@AF;57 F:7M 0, '+"(' 0 * "+ (," NFA#7EEAD@AF>7EEF:3@@;@7FK 63KEBD;ADFAF:7F:7@5GDD7@F JB;D3F;A@3F73@6I;F:AGFF:7D7CG;D7?7@FA83@K8GDF:7D35F;A@A@F:7B3DFA87;F:7D#7EEADAD#7EE77 >89*243897:(9.43&3)&.39*3&3(**:DAG9:AGFF:7#73E7*7D?3@6F:DAG9:F:7 (7?AH3>3F7*7D?#7EE77E:3>>:3H7F:7D;9:FFAB7D8AD?AD53GE7FA47B7D8AD?763>>F3E=E@757EE3DK AD3BBDABD;3F73ED73EA@34>K67F7D?;@764K#7EE77FA53DDKAGFF:735F;H;F;7EE7F8ADF:;@F:;E9D77?7@F ;@5>G6;@9I;F:AGF>;?;F;@9F:797@7D3>;FKA8F:78AD79A;@9F:7D;9:F;FA67E;9@5A@EFDG5F;@EF3>>3@6 AB7D3F7F:7)KEF7?;;FA?3;@F3;@5>73@D7B3;DD7B>357366FAD7?AH7AD?A6;8KF:7)KEF7?AD3@KB3DF F:7D7A83E67F7D?;@76FA47@757EE3DK4K#7EE77;@;FEEA>76;E5D7F;A@3@6;@355AD63@57I;F:F:7'7D?;FE 3@6BB>;534>7#3IE;;;FAGE73@K3@63>>3BBDABD;3F7?73@EA8D7EFD;5F;@93557EEFAF:7)KEF7?3@6 'D7?;E7E;@5>G6;@9I;F:AGF>;?;F3F;A@F:75A@EFDG5F;A@A8387@573@6;HFAB7D?3@7@F>K9DG43@69D367 F:7'D7?;E7E3@6FAB7D?3@7@F>KD7?AH73@6 AD5>73D3@KFD77EH797F3F;A@EFDG5FGD7EDA5=EI3F7D5AGDE7E FAF:77JF7@FB7D?;EE;4>7ADAF:7D7@5G?4D3@57E7J;EF;@9A@F:7'D7?;E7E67F7D?;@76FA47@757EE3DK4K #7EE77;@;FEEA>76;E5D7F;A@3@6;@355AD63@57I;F:F:7'7D?;FE3@6BB>;534>7#3IE J57BF3E?3K AF:7DI;E747EB75;8;53>>K39D776GBA@4KF:7'3DF;7EAD3E7JBD7EE>KE7F8ADF::7D7;@#7EE77E:3>>47 D7EBA@E;4>78AD3>>5AEFEA867E;9@B7D?;FF;@95A@EFDG5F;A@;@EF3>>3F;A@AB7D3F;A@3@6?3;@F7@3@57A8F:7 )KEF7?3@6)KEF7?(7?AH3> #7EE77E:3>>BDAH;678ADI7765A@FDA>;@3?3@@7DF:3FBD7H7@FEF:7EBD736 A8I776EA@FAF:7'DAB7DFKAD36<357@F>3@6GE768AD39D;5G>FGD3>BGDBAE7E N *72.98 *8847445*7&9.43'D;ADFA5A??7@57?7@FA85A@EFDG5F;A@A8F:7)KEF7?4K #7EE77#7EE77E:3>>A4F3;@F:7@757EE3DK'7D?;FE @F:77H7@F#7EE77;@;FEEA>76;E5D7F;A@E:3>>67F7D?;@7 F:3FF:7'D7?;E7EE:AG>647EG46;H;676FA355A??A63F7F:75A@EFDG5F;A@AB7D3F;A@3@6 AD?3;@F7@3@57A8 F:7)KEF7?EADFA5A?B>KI;F:'7D?;FE3@6BB>;534>7#3IE#7EEADE:3>>8G>>K5AAB7D3F7I;F:#7EE77FA 835;>;F3F73@653GE73@K3BB>;53F;A@8ADEG46;H;E;A@A8F:7'D7?;E7EFA473BBDAH76BDAH;676F:3F#7EE77 E:3>>B3K3>>5AEFE3@67JB7@E7ED7>3F76F:7D7FA 9&9:947>&3)*,:1&947>4251.&3(* #7EE77F:7#7EE77'3DF;7E#7EEAD3@6F:7#7EEAD '3DF;7EE:3>>735:5A?B>KI;F:3>>3BB>;534>7BDAH;E;A@EA83>>BB>;534>7#3IEA8F:7>A53>;FK;@I:;5:F:7 'DAB7DFK;E>A53F76 *88**@8 <3*78-.5 4+ >89*28 &3) :95:9 *:7 )KEF7?E 3D7 B7DEA@3> BDAB7DFK I:7F:7DAD@AFF:7E3?7;E677?76D73>ADB7DEA@3>BDAB7DFKG@67DBB>;534>7#3I3@6E:3>>@AF3FF35:FA AD47677?763B3DFA8AD38;JFGD7FAF:7'D7?;E7EAD'DAB7DFK #7EE77AD;FE67E;9@77EE:3>>47F:7>793> 3@647@78;5;3>AI@7DEA8F:73BB>;534>7)KEF7?E3F3>>F;?7E3@6#7EEADE:3>>:3H7@AD;9:FF;F>7AD;@F7D7EF ;@3@KA8F:7)KEF7?EAD3@K5A?BA@7@FF:7D7A8@AFI;F:EF3@6;@9F:3F3@KEG5:)KEF7?E?3K47B:KE;53>>K ?AG@F76AD36:7D76FAF:7'D7?;E7EAD'DAB7DFK #7EEAD5AH7@3@FEF:3F;FI;>>GE75A??7D5;3>>KD73EA@34>7 788ADFEFAB>3573>>B3DF;7E:3H;@93@;@F7D7EF;@AD>;7@GBA@F:7'DAB7DFKADF:7'D7?;E7EA@@AF;57A8F:7 AI@7DE:;BA8F:7)KEF7?3@6F:7>793>EF3FGEAD5>3EE;8;53F;A@A8F:7)KEF7?3EB7DEA@3>BDAB7DFK 8F:7D7 ;E3@K?ADF9397AD8;JFGD78;>;@9393;@EFF:7'DAB7DFKAD'D7?;E7EI:;5:5AG>6D73EA@34>K475A@EFDG763E 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 3FF35:;@9FAF:7)KEF7?E3E38;JFGD7A8F:7'DAB7DFKAD'D7?;E7E#7EEADE:3>>BDAH;6736;E5>3;?7DADD7>73E7 8DA?EG5:>;7@:A>67D;@8AD?3@6EG4EF3@57D73EA@34>KE3F;E835FADKFA#7EE773@63@K ;@3@5;@9'3DFK #7EEAD3EF:7877AI@7DA8F:7'DAB7DFK5A@E7@FEFAF:78;>;@94K#7EE77A@47:3>8A8#7EEADAD;FE 67E;9@77E3E3BB>;534>7A836;E5>3;?7DA8F:7)KEF7?E3E38;JFGD7A8F:7'DAB7DFKAD'D7?;E7E;@F:7A88;57 I:7D7 D73> 7EF3F7 D75AD6E 3D7 5GEFA?3D;>K 8;>76 ;@ F:7 <GD;E6;5F;A@ A8 F:7 'DAB7DFK GDF:7D #7EEAD 35=@AI>7697E3@639D77EF:3F#7EE77AD;FE67E;9@77E3E3BB>;534>73D7F:77J5>GE;H7AI@7DEA83>> 7>75FD;5;FK3@63>>GF;>;FK5D76;FE;@5>G6;@9D7@7I34>77@7D9K5D76;FE7@H;DA@?7@F3>5D76;FE3@6F3J5D76;FE 97@7D3F764K3@6 ADEFAD76I;F:;@F:7)KEF7?3@6AI@7DEA83>> @H;DA@?7@F3>FFD;4GF7E3@6 @57@F;H7E 3FFD;4GF34>7FAF:7)KEF7? @F:734E7@57A83@366;F;A@3>39D77?7@FFAF:75A@FD3DK3>>7>75FD;5;FK 97@7D3F764K3@6 ADEFAD76I;F:;@F:7)KEF7?EI;>>475A@@75F76FAF:76;EFD;4GF;A@9D;63@6EA>64K#7EE77 FAF:;D6B3DF;7E3@6I;>>@AF473H3;>34>7FA#7EEADAD3@KAF:7DA55GB3@F3FF:7'DAB7DFK -;F:AGFF:7 7JBD7EE5A@E7@FA8#7EE77#7EEADE:3>>@AF?3=7ADBG4>;E:3@KBG4>;5EF3F7?7@FAD@AF;57D793D6;@93@K @H;DA@?7@F3>FFD;4GF7E3@6 @57@F;H7ED7>3F;@9FAF:7)KEF7?ADF:77>75FD;5;FK97@7D3F764K3@6 ADEFAD76 I;F:;@F:7)KEF7? *57*8*39&9.43&3) &77&39.*84+9-*&79.*8&894 :9-47.?&9.43&3)3+47(*&'.1.9> 35:'3DFKD7BD7E7@FE3@6I3DD3@FEF:3FF:77J75GF;A@3@667>;H7DK4KEG5:'3DFKA83@6F:7B7D8AD?3@57 A8;FEA4>;93F;A@EG@67DF:;E9D77?7@F:3H7477@6G>K3GF:AD;L764K3>>@757EE3DK35F;A@6A@AF3@6I;>> @AFD7CG;D73@K8GDF:7D5A@E7@FAD3BBDAH3>A83@KAF:7D'7DEA@3@66A@AF5A@FD3H7@73@KBDAH;E;A@A8AD 5A@EF;FGF736783G>FG@67D3@K;@67@FGD7?ADF9397>73E773E7?7@F7@5G?4D3@57D;9:FD7EFD;5F;A@ADAF:7D ?3F7D;3>39D77?7@F4;@6;@9A@EG5:'3DFKAD3@KH3>;6AD67DA83@K5AGDFADD79G>3FADK397@5KADAF:7D 4A6K:3H;@93GF:AD;FKFAI:;5:EG5:'3DFK;EEG4<75F 35:'3DFKD7BD7E7@FE3@6I3DD3@FEF:79D77?7@F 5A@EF;FGF7E3>793>3@6H3>;6A4>;93F;A@A8EG5:'3DFK7@8AD5734>7393;@EF;F;@355AD63@57I;F:;FEF7D?E 7J57BF3E?3K47>;?;F764K33@=DGBF5K H7@FD7AD93@;L3F;A@;@EA>H7@5K43@=?AD3FAD;G?AD>3IE D7>3F;@9FAAD38875F;@95D76;FADEPD;9:FE97@7D3>>K3@697@7D3>BD;@5;B>7EA87CG;FKI:7D7EG5:7@8AD5734;>;FK ;E5A@E;67D76;@3BDA5776;@9;@7CG;FKAD3F>3I *57*8*39&9.438 &77&39.*8&3)4;*3&3984+9-**8847 3%AA@8>;5F #7EEADD7BD7E7@FE3@6I3DD3@FEF:3FF:77J75GF;A@67>;H7DK3@6 B7D8AD?3@574K;FA8F:;E9D77?7@F6A7E@AF;H;A>3F7;FEAD93@;L3F;A@3>6A5G?7@FEAD3@KBB>;534>7 #3IAD;;D7CG;D73@K3BBDAH3>AD5A@E7@FA83@KAF:7D'7DEA@7J57BF8ADEG5:3BBDAH3>EAD5A@E7@FEF:3F :3H7477@A4F3;@76A@AD478AD7F:763F7:7D7A8ADF:734E7@57A8I:;5:5AG>6@AF;@6;H;6G3>>KAD;@F:7 399D793F7D73EA@34>K477JB75F76FA:3H73?3F7D;3>36H7DE778875FA@;FE34;>;FKFA7J75GF767>;H7DAD B7D8AD?F:;E9D77?7@F 35:'7DEA@E;9@;@9F:;E9D77?7@FA@47:3>8A8#7EEAD;E3GF:AD;L76FA6AEA 4#7EEADPE*;F>7FA'D7?;E7E #7EEADD7BD7E7@FEI3DD3@FE3@65AH7@3@FEF:3F#7EEAD :3E;3>3I8G>877E;?B>7;@F7D7EF;@F;F>7FAF:7'DAB7DFK;@5>G6;@9F:7'D7?;E7EEG4<75FFA3@K?ADF9397E >73E7E73E7?7@FE5AH7@3@FED7EFD;5F;A@E3@6D;9:FEA8D75AD6F:3F?3K7J;EF3@6;;F:3F#7EE77E:3>>:3H7 CG;7F3@6B73578G>BAEE7EE;A@A8F:7'D7?;E7E8D778DA?3@K5>3;?A83@K7@F;FKAD'7DEA@A8EGB7D;ADF;F>7 F:7D7FAI;F:AGF:;@6D3@57FAAD;@F7D87D7@57I;F:AD?A>7EF3F;A@A8#7EE77PECG;7F7@<AK?7@FF:7D7A8 F:DAG9:AGFF:7#73E7*7D? #7EEAD3F;FEEA>75AEF3@67JB7@E7E:3>>5A?B>KI;F:3>>D7EFD;5F;H75AH7@3@FE ADAF:7DF;F>77J57BF;A@E38875F;@9F:7'D7?;E7EFAF:77JF7@FF:3FF:7E3?73D73BB>;534>7FAF:7'D7?;E7EAD FAF:77JF7@FF:3FF:7E3?7IAG>6;8@AF5A?B>;76I;F:ADB7D8AD?76;?B3;DADBD7H7@FF:75A@F;@G76GE7 A55GB3@5K3@6AB7D3F;A@A8F:7'D7?;E7E8ADF:7BGDBAE7EE7F8ADF:;@F:;E9D77?7@F3@6#7EEAD39D77EFA F3=73>>35F;A@@757EE3DKFA7>;?;@3F7EG5:;@F7D87D7@57 @F:77H7@F#7EEAD83;>EFA5A?B>KI;F:F:;E BDAH;E;A@#7EE77?3KJF7D?;@3F7F:;E9D77?7@FKF3=73>>@757EE3DKEF7BEFA4D;@9#7EEAD;@FA 5A?B>;3@57I;F:3@KD7EFD;5F;H75AH7@3@FEADF;F>77J57BF;A@EI:;5:;8@AF5A?B>;76I;F:IAG>6;?B3;DAD BD7H7@F#7EE778DA?7J7D5;E;@9;FED;9:FEG@67DF:;E9D77?7@F3@6#7EEADE:3>>47D7EBA@E;4>78AD3>>5AEFE ;@5GDD764K#7EE778ADEG5:35F;A@E3@6 ADLBGDEG73@KAF:7DD7?76;7E3H3;>34>7G@67DF:;E9D77?7@F 3F>3I3@6 AD3F7CG;FK 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 57875FE #7EE77:3EF:7D;9:FFAA4F3;@3F;F>7D7BADFAD5A??;F?7@F8AD3>73E7:A>6 F;F>7BA>;5K8DA?3F;F>7;@EGD3@575A?B3@KA8;FE5:A;57 #7EEADE:3>>8G>>K5AAB7D3F7I;F:#7EE773F@A5AEF FA#7EEADFA7@34>7#7EE77FAA4F3;@3EF3@63D6BA>;5KA8F;F>7;@EGD3@57;@EGD;@9F:7BDAB7DFK;@F7D7EFE 9D3@F76:7D7G@67D;@5>G6;@9EG5:7@6ADE7?7@FE3E#7EE77E:3>>D73EA@34>KD7CG7EF #7EEAD39D77EF:3F #7EEADI;>>7J75GF73@667>;H7DFA#7EE773@K6A5G?7@FED73EA@34>KD7CG;D764KF:7F;F>7;@EGD3@575A?B3@K I;F:;@8;H7GE;@7EE3KE38F7DBD7E7@F3F;A@A8E3;66A5G?7@FE4K#7EE77 ;@@A 7H7@FI;>>EG5:6A5G?7@FE?3F7D;3>>K;@5D73E73@KA4>;93F;A@AD?3F7D;3>>K675D73E73@KD;9:FA8#7EEAD :7D7G@67D 6*D3@E87DE #7EEADE:3>>@AF3EE;9@;FE;@F7D7EF;@F:7'D7?;E7EE7B3D3F78DA?;FE AI@7DE:;B;@F7D7EF3@6E:3>>@AF>73E7F:7'D7?;E7EFA3@KAF:7D'7DEA@ +BA@F:7E3>7A8F:7'DAB7DFK #7EEADE:3>>3EE;9@3>>A8;FED;9:FE3@6A4>;93F;A@E:7D7G@67DFA3@KBGD5:3E7DA8F:7'DAB7DFK3@6EA>A@9 3EEG5:BGD5:3E7D3EEG?7EF:7A4>;93F;A@FAB7D8AD?3>>A4>;93F;A@EG@67DF:;E9D77?7@F;@ID;F;@9#7EEAD E:3>>47D7>73E768DA?>;34;>;FK:7D7G@67D355DG;@98DA?3@638F7DF:778875F;H763F7A8EG5:BGD5:3E73@6 3EE;9@?7@F #7EEADE:3>>@AF?ADF93973>;7@3F7ADAF:7DI;E77@5G?47DF:7'D7?;E7EI;F:AGF8;DEFA4F3;@;@9 3%BGDEG3@FFA)75F;A@ 847>AI #7EEADE:3>>BDAH;67@AF;57FA#7EE773F>73E7F:;DFK 63KEBD;AD FA3@KE3>7?ADF9397AD7@5G?4D3@57A8F:7'DAB7DFK #7EEAD39D77EF:3FF:;E9D77?7@F3@6F:7>73E73@6 F:7 3E7?7@FE9D3@F76:7D7G@67DE:3>>DG@I;F:F:7'DAB7DFK3@6 ADF:7'D7?;E7E3@6EGDH;H73@KFD3@E87D A83>>AD3@KBADF;A@A8F:7'DAB7DFK3@6 ADF:7'D7?;E7E @8GDF:7D3@57A8F:78AD79A;@9#7EEADE:3>>53GE7 3@KBGD5:3E7D>7EE773EE;9@77?ADF93977B>7697E75GD76B3DFKADB3DFKFAI:A?3>;7@A@F:7'D7?;E7E AD'DAB7DFK:3E477@9D3@F76FA7J75GF73@667>;H7DFA#7EE7735A??7D5;3>>KD73EA@34>76A5G?7@FBGDEG3@F FAI:;5:EG5:B3DFK35=@AI>7697E3@65A@E7@FEFAF:7#7EE77PED;9:FE;@F:7'D7?;E7E3EE7F8ADF::7D7;@ ;@5>G6;@9I;F:AGF>;?;F3F;A@3@35=@AI>7697?7@F4KF:7FD3@E87D77F:3F;F:3E@A;@F7D7EF;@F:7)KEF7?E AD3@KIAD=D7>3F76FAEG5:)KEF7?E3@6E:3>>@AF93;@3@K;@F7D7EF;@F:7)KEF7?E4KH;DFG7A8F:7#7EEADPE FD3@E87D 7%A @F7D87D7@57-;F:3@6'DAF75F;A@A8)KEF7? #7EEADI;>>@AF5A@6G5F35F;H;F;7E A@;@AD34AGFF:7'DAB7DFKAD'D7?;E7EF:3F:3H73D73EA@34>7>;=7>;:AA6A853GE;@963?397;?B3;D?7@F ADAF:7DI;E736H7DE7>K38875F;@9F:7)KEF7?ADAB7D3F;A@F:7D7A8 *:7)KEF7?E:3>>47AB7D3F76?3;@F3;@76 3@6D7B3;D764K#7EE773F;FEEA>75AEF3@67JB7@E7BDAH;676F:3F3@KD7B3;DAD?3;@F7@3@575AEFE;@5GDD76 4K#7EE773E3D7EG>FA8#7EEADPE@79>;97@57?;E5A@6G5FAD4D735:A8;FEA4>;93F;A@E:7D7G@67DE:3>>47 BDA?BF>KD7;?4GDE76FA#7EE774K#7EEAD 8%A@;EFGD43@579D77?7@FE #7EEADE:3>>3F;FEEA>7788ADF3@67JB7@E7A4F3;@ 3@A@6;EFGD43@5739D77?7@FMN;@83HADA8#7EE778DA?3@KF:;D6B3DFKI:A@AI:3EAD?3K;@F:7 8GFGD7A4F3;@3@;@F7D7EF;@F:7'DAB7DFKAD'D7?;E7E;@5>G6;@9I;F:AGF>;?;F3F;A@3@K>7@67DEFA#7EEAD ;@38AD?3557BF34>7FA#7EE77I:;5:%E:3>>;35=@AI>76973@65A@E7@FFA#7EE77PED;9:FEFAF:7 'D7?;E7E3@6F:7)KEF7?EG@67DF:;E9D77?7@F;;35=@AI>7697F:3FF:7F:;D6B3DFK:3E@A;@F7D7EF;@F:7 )KEF7?E3@6E:3>>@AF93;@3@K;@F7D7EF;@F:7)KEF7?E4KH;DFG7A8F:7'3DF;7EPB7D8AD?3@57AD4D735:A8 F:;E9D77?7@F;;;35=@AI>7697F:3FF:7F:;D6B3DFKPE;@F7D7EF;@F:7'D7?;E7E;83@K;EEG4<75FFA#7EE77PE ;@F7D7EFG@67DF:;E9D77?7@F;HI3;H7E3@K>;7@F:7F:;D6B3DFK?3K:3H7;@3@6FAF:7)KEF7?E3@6H 39D77E@AFFA6;EFGD4#7EE77PEBAEE7EE;A@A8F:7'D7?;E7E 9 @EA>3F;A@ #7EEAD35=@AI>7697E3@639D77EF:3F3557EEFAEG@>;9:FM '+(%,"('N ;E7EE7@F;3>FAF:7H3>G7FA#7EE77A8F:7>73E7:A>6;@F7D7EF9D3@F76:7D7G@67D3@6;E3?3F7D;3>;@6G57?7@F FA#7EE77;@7@F7D;@9;@FAF:;E9D77?7@F 55AD6;@9>K#7EEADE:3>>@AFB7D?;F3@K;@F7D87D7@57A@F:7 'DAB7DFK7J5>GE;H7A8F:7'D7?;E7EAD3@K@7;9:4AD;@9BDAB7DFKG@67D#7EEADPEAD;FE88;>;3F7PE5A@FDA> I:;5:;@F7D87D7EI;F: @EA>3F;A@A@3@63FF:7'D7?;E7E -;F:AGF>;?;F;@9F:78AD79A;@9#7EEADE:3>>@AF 5A@EFDG5FADB7D?;FFA475A@EFDG5F76A@F:7'DAB7DFKAD3@K36<A;@;@9BDAB7DFKG@67D#7EEADPE5A@FDA>3@K EFDG5FGD7A@AD36<357@FFAF:7'D7?;E7EADA@3@K36<357@FBDAB7DFKAI@764K3@K88;>;3F7A8#7EEADF:3F 5AG>636H7DE7>K38875F @EA>3F;A@>7H7>EA@F:7'D7?;E7EE:3>>@AFB7D?;FF:79DAIF:A88A>;397A@F:7 'DAB7DFK7J5>GE;H7A8F:7'D7?;E7EAD3@K@7;9:4AD;@9BDAB7DFKG@67D#7EEADPEAD;FE88;>;3F7PE5A@FDA> F:3F5AG>636H7DE7>K38875F @EA>3F;A@>7H7>EA@F:7'D7?;E7EAD6;D75F>K7?;FADB7D?;FF:77?;EE;A@A8 'RFX6LJQ(QYHORSH,' )( % %$))&' ' EGEB7@676B3DF;5G>3F7?3FF7DE?A=78A9ADEF73?ADAF:7D3;D4AD@7;?B76;?7@FEFA @EA>3F;A@A@F:7 'D7?;E7E 8#7EEAD475A?7E3I3D7A83@KBAF7@F;3>67H7>AB?7@FADAF:7D35F;H;FKA@36<357@FAD@73D4K BDAB7DF;7EF:3F5AG>66;?;@;E:F:7 @EA>3F;A@FAF:7'D7?;E7E#7EEADE:3>>BDA?BF>K36H;E7#7EE77A8EG5: ;@8AD?3F;A@ 3@6 D73EA@34>K 5AAB7D3F7 I;F: #7EE77 ;@ F3=;@9 ?73EGD7E FA BD7E7DH7 3H7D397 >7H7>E A8 @EA>3F;A@3FF:7'D7?;E7E3EF:7K7J;EF763EA8F:7#73E7A??7@57?7@F3F7 )G5:?73EGD7E?3K ;@5>G674GF@AF47>;?;F76FAA4F3;@;@93EA>3D;@EA>3F;A@73E7?7@F @F:77H7@F3@KEG5:A4EFDG5F;A@ A55GDE3@6;E@AFBDA?BF>KD7?AH768A>>AI;@9@AF;57A8EG5:A4EFDG5F;A@#7EE77E:3>>:3H7F:7D;9:FFA D7?AH7EG5:A4EFDG5F;A@A@F:7'DAB7DFKAD3@K@7;9:4AD;@9BDAB7DFKG@67D#7EEADPEAD;FE88;>;3F7PE 5A@FDA>3F#7EEADPE5AEFADF7D?;@3F7F:;E9D77?7@FI;F:AGFB7@3>FKAD8GDF:7D>;34;>;FKGBA@@AF;57FA #7EEAD 66;F;A@3>>K#7EE77E:3>>:3H7F:7D;9:FGBA@@A>7EEF:3@FI7@FK8AGD :AGDEP@AF;57FA#7EEAD FAD7?AH75GFADFD;?3@KFD77E3@6 AD3@KAF:7DH797F3F;A@A@F:7'DAB7DFKADA@3@KAF:7DBDAB7DFKAD >3@6AI@764K#7EEADAD;FE88;>;3F7I:;5:;E36<357@FFAF:7'DAB7DFKI:;5:?3F7D;3>>K;?B35FEF:7 @EA>3F;A@A@F:7'D7?;E7E %AFI;F:EF3@6;@93@KAF:7DBDAH;E;A@A8F:;E9D77?7@FF:7'3DF;7E39D77F:3F ;#7EE77IAG>647;DD7B3D34>K:3D?764K34D735:A8F:7BDAH;E;A@EA8F:;E)75F;A@ 9;;3@3I3D6A8 63?397E?;9:F47;@367CG3F7FAD7?76KEG5:34D735:3@6;;;#7EE77E:3>>477@F;F>76FA7CG;F34>7D7>;78 ;@5>G6;@9EB75;8;5B7D8AD?3@57FA5A?B7>5A?B>;3@57I;F:F:7BDAH;E;A@EA8F:;E)75F;A@ 9 #7EEAD 8GDF:7DD7BD7E7@FE3@6I3DD3@FEF:3FFAF:747EFA8;FE=@AI>7697F:7D73D7@A67H7>AB?7@FEB7@6;@9AD;@ BDA9D7EEA@36<357@FAD@73D4KBDAB7DF;7EF:3F5AG>66;?;@;E:F:7 @EA>3F;A@FAF:7'D7?;E7E : 3L3D6AGE)G4EF3@57E #7EEADD7BD7E7@FE3@6I3DD3@FEF:3FF:7D73D7@A 3L3D6AGE )G4EF3@57EBD7E7@FA@;@ADG@67DF:7'DAB7DFKAD'D7?;E7E;@H;A>3F;A@A83@KBB>;534>7#3I ;A@6;F;A@A8'D7?;E7E J57BF3EAF:7DI;E77JBD7EE>KE7F8ADF::7D7;@#7EE77 3557BFEF:7'D7?;E7EM3E;ENI;F:AGF47@78;FA83@K;?BDAH7?7@FEAD?A6;8;53F;A@EFA47?3674K#7EEAD #7EEADD7BD7E7@FE3@6I3DD3@FEFA#7EE77F:3FFAF:747EFA8;FE=@AI>7697F:7D73D7@AE;F75A@6;F;A@E3F F:7'DAB7DFKAD'D7?;E7EI:;5:IAG>6;?3F7D;3>>K;@5D73E7F:75AEFA8;@EF3>>;@9F:7)KEF7?3FF:7B>3@@76 >A53F;A@EA@F:7'D7?;E7EADIAG>6?3F7D;3>>K;@5D73E7F:75AEFA8?3;@F3;@;@9F:7)KEF7?3FF:7'D7?;E7E AH7DF:75AEFF:3FIAG>647FKB;53>AD5GEFA?3DK8AD3EG4EF3@F;3>>KE;?;>3D)KEF7?AD;;36H7DE7>K38875F F:734;>;FKA8F:7)KEF7?3E67E;9@76FABDA6G57EFAD73@6 AD;@<75F7>75FD;5;FKA@57;@EF3>>7634E7@F 5A@6;F;A@E47KA@6#7EEADPED73EA@34>75A@FDA> <%AF;57A83?397AD ?7D97@5K #7EEADE:3>>;??76;3F7>K@AF;8K#7EE77;8#7EEAD 475A?7E3I3D7F:DAG9:6;E5AH7DKADD757;BFA8@AF;57;A83@K63?397FAAD>AEEA8F:7GE7A8F:7)KEF7? ;;A83@K7H7@FAD5;D5G?EF3@57F:3FBAE7E3@;??;@7@FD;E=FA:G?3@:73>F:F:77@H;DA@?7@FF:7)KEF7? ADF:7'D7?;E7EAD;;;A83@K;@F7DDGBF;A@AD?3F7D;3>3>F7D3F;A@A8F:77@7D9KEGBB>KFAAD8DA?F:7 'D7?;E7EADF:7)KEF7? =#;7@E3@6*7@3@FE J57BF3E?3K476;E5>AE76;@F:7D73>BDAB7DFKD75AD6EA8F:7 AG@FK#7EEADD7BD7E7@FEF:7D73D7@A7@5G?4D3@57E>73E7E?ADF9397E6776EA8FDGEF6776EFAE75GD7 674FADE;?;>3D>;7@EADE75GD;FK;@F7D7EFE7@5G?47D;@93>>AD3@KBADF;A@A8F:7'DAB7DFK3@6 ADF:7'D7?;E7E F:3F5AG>6;@F7D87D7I;F:#7EE77PEAB7D3F;A@EA@F:7'D7?;E7E;@5>G6;@9?75:3@;5PE>;7@E #7EEADE:3>>@AF 6;D75F>KAD;@6;D75F>K53GE75D73F7;@5GD3EEG?7ADEG887DFA7J;EF3@K?ADF9397B>7697>;7@;@5>G6;@9 ?75:3@;5EP>34ADAD?3F7D;3>?3@PE>;7@5:3D97E75GD;FK;@F7D7EF7@5G?4D3@57AD5>3;?A@ADI;F:D7EB75F FAF:7)KEF7?EF:7'D7?;E7EAD3@K;@F7D7EFF:7D7;@ #7EEADE:3>>BDAH;67#7EE77I;F:@AF;57;8;FD757;H7E @AF;57A83@KEG5:5>3;?E #7EEAD8GDF:7D39D77EFA6;E5:3D97AD4A@63F;FEEA>77JB7@E73@KEG5: 7@5G?4D3@57AD;@F7D7EFF:3F3FF35:7EFAF:7)KEF7?E3@6FA;@67?@;8K6787@63@6:A>6:3D?>7EE#7EE77 8DA?3@K5AEFE>AEE7E7JB7@E7EAD>;34;>;F;7E3D;E;@98DA?F:7E3?7;@5>G6;@9I;F:AGF>;?;F3F;A@#7EE77PE 3FFAD@7KEP877E3@65AGDF5AEFE #7EEADI3;H7E3@K3@63>>>;7@D;9:FE;F?3K:3H7EF3FGFADKADAF:7DI;E7 5A@57D@;@9F:7)KEF7?AD3@KBADF;A@F:7D7A8 >$;@7D3>(;9:FE #7EEADD7BD7E7@FE3@6I3DD3@FEF:7D73D7@A7J;EF;@9?;@7D3>A;> 3@693EI3F7DAD@3FGD3>D7EAGD57D;9:FEF:3F5AG>6;@F7D87D7I;F:#7EE77PED;9:FE:7D7G@67D GD;@9F:7 #73E7*7D?#7EEAD?3K@AFGE7AD9D3@FF:7GE7A8F:7'D7?;E7E8ADF:7BGDBAE7A87JB>AD;@98AD 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 7JFD35F;@9BDA6G5;@9AD?;@;@9EG5:A;>93E?;@7D3>EADAF:7D@3FGD3>D7EAGD57E;@5>G6;@9E7>>;@9AD >73E;@9EG5:;@F7D7EFEFA3F:;D6B3DFK8DA?F:7EGD8357FA367BF:A8 877F47>AIF:7EGD8357 #7EEAD?3K 7JB>AD78AD7JFD35FADBDA6G57A;>93E?;@7D3>E3@6AF:7D@3FGD3>D7EAGD57E8DA?F:7'DAB7DFK;@3?3@@7D I:;5:6A7E@AF;@F7D87D7I;F:#7EE77PEGE7A8F:7'D7?;E7EAD38875FF:7)KEF7?3@6GF;>;L7E3?7F:A6EG5: 3EM6;D75F;A@3>6D;>>;@9NI:;5:6A7E@AFD7CG;D7F:7GE7A8F:7'D7?;E7EFA367BF:A88;H7:G@6D76 877F 47>AIF:7EGD8357 ?#;F;93F;A@ %A>;F;93F;A@;EB7@6;@93@6FAF:747EFA8#7EEADPE=@AI>7697@A 35F;A@E5>3;?EADAF:7D>793>AD36?;@;EFD3F;H7BDA5776;@9E3D7B7@6;@9F:D73F7@76AD3@F;5;B3F76I;F: D7EB75FFAADI:;5:5AG>638875FF:7'D7?;E7EAD#7EEADPED;9:FAD3GF:AD;FKFA7@F7D;@FAF:;E9D77?7@F 8#7EEAD>73D@EF:3F3@KEG5:>;F;93F;A@35F;A@5>3;?ADBDA5776;@9;EF:D73F7@76AD:3E477@;@EF;FGF76 #7EEADI;>>BDA?BF>K67>;H7D@AF;57F:7D7A8FA#7EE77 @(7BD7E7@F3F;A@E(793D6;@9)75GD;FK @F7D7EF;@)KEF7? #7EEAD:3E477@36H;E76 F:3FB3DFA8F:75A>>3F7D3>E75GD;@9F:78;@3@5;3>3DD3@97?7@FE8ADF:7)KEF7??3K47F:79D3@F;@9A838;DEF BD;AD;FKB7D875F76B7DEA@3>BDAB7DFKE75GD;FK;@F7D7EFG@67DF:7+@;8AD?A??7D5;3>A67F:7M -*",1 ', * +,N;@F:;E>73E7:A>63@6F:7 3E7?7@FEAD3@KBADF;A@F:7D7A8AD;@F:7)KEF7?EFAA@7AD?AD7 ;@3@5;@9'3DF;7E3@6#7EEAD:7D74K5A@E7@FEFAF:79D3@F;@9A8EG5:)75GD;FK @F7D7EF @5A@@75F;A@ F:7D7I;F:#7EEADD7BD7E7@FE3@6I3DD3@FE3E8A>>AIE;F:79D3@F;@9A8F:7)75GD;FK @F7D7EFI;>>@AFH;A>3F7 3@K F7D? AD 5A@6;F;A@ A8 3@K 5AH7@3@F D7EFD;5F;A@ >;7@ 8;@3@5;@9 39D77?7@F AD E75GD;FK 39D77?7@F 38875F;@9F:7'DAB7DFKAD'D7?;E7E;;F:7D7;E@A7J;EF;@9>73E7?ADF9397E75GD;FK;@F7D7EF73E7?7@F 5>3;?GE7ADD7EFD;5F;A@ADAF:7D;@F7D7EF;@AD>;7@GBA@F:7'DAB7DFKAD'D7?;E7EF:3F5AG>63FF35:FAF:7 )KEF7?E3E3@;@F7D7EF36H7DE7FAADE7@;ADFA#7EE77PE ;@3@5;@9'3DF;7EP)75GD;FK @F7D7EFF:7D7;@;;;F:7D7 7J;EFE@A7H7@FAD5A@6;F;A@I:;5:5A@EF;FGF7E36783G>FADIAG>6I;F:F:79;H;@9A8@AF;57AD>3BE7A8F;?7 5A@EF;FGF736783G>FG@67DF:79D77?7@F3@6;HF:7D7;E@A7J;EF;@9?;@7D3>A;>3@693EI3F7DAD@3FGD3> D7EAGD57D;9:FF:3F5AG>63FF35:FAF:7)KEF7?E3E3@;@F7D7EF36H7DE7FAADE7@;ADFA#7EE77PE ;@3@5;@9 '3DF;7EP)75GD;FK @F7D7EFF:7D7;@ &?&7)4:8 :'89&3(*8%7;F:7D'3DFKE:3>>;@FDA6G57ADGE73@K 3L3D6AGE)G4EF3@57E A@;@ADG@67DF:7'D7?;E7EAD'DAB7DFK;@H;A>3F;A@A83@KBB>;534>7#3I 83'3DFK475A?7E3I3D7A8 3@K 3L3D6AGE)G4EF3@57EA@;@ADG@67DF:7'D7?;E7EAD'DAB7DFK;FE:3>>BDA?BF>K@AF;8KF:7AF:7D'3DFK A8F:7FKB73@6>A53F;A@A8EG5: 3L3D6AGE)G4EF3@57E;@ID;F;@9 35:'3DFK39D77EFA;@67?@;8K6787@6 3@6:A>6:3D?>7EEF:7AF:7D'3DFK3@6;FE88;>;3F7E3@6F:7;D7?B>AK77E3@6397@FE8DA?3@6393;@EF3@K 3@63>>36?;@;EFD3F;H73@6<G6;5;3>35F;A@E3@6DG>;@9E5>3;?E53GE7EA835F;A@67?3@6E3@6>;34;>;FK ;@5>G6;@94GF@AF>;?;F76FA63?397E5AEFE7JB7@E7E3EE7EE?7@FEB7@3>F;7E8;@7E>AEE7E<G69?7@FE3@6 D73EA@34>73FFAD@7K877EF:3F3@K'3DFK?3KEG887DAD;@5GD6G7FAF:77J;EF7@57A83@K 3L3D6AGE)G4EF3@57E A@F:7'DAB7DFKADF:7?;9D3F;A@A83@K 3L3D6AGE)G4EF3@57FAAF:7DBDAB7DF;7EADF:7D7>73E7A83@K 3L3D6AGE)G4EF3@57;@FAF:77@H;DA@?7@FM '."*('& ',%%"&+NF:3FD7>3F7FAAD3D;E78DA?EG5: '3DFKPE35F;H;F;7EA@F:7'DAB7DFKAD'D7?;E7E7J57BFFAF:77JF7@F6;D75F>K3FFD;4GF34>7FAF:7@79>;97@F35FE ADA?;EE;A@EADI;>>8G>?;E5A@6G5FA8F:7AF:7D'3DFK #7EEADE:3>>8GDF:7D;@67?@;8K6787@63@6:A>6 :3D?>7EE #7EE77 3@6 ;FE 88;>;3F7E 3@6 F:7;D 7?B>AK77E 3@6 397@FE 8DA? 3@6 393;@EF 3@K 3@6 3>> @H;DA@?7@F3>>3;?E6G7FAF:7BD7E7@57A83@K 3L3D6AGE)G4EF3@57E;@A@ADG@67DF:7'D7?;E7E3EA8 F:7 8875F;H73F7 *:7;@67?@;8;53F;A@E;@F:;E)75F;A@ EB75;8;53>>K;@5>G67I;F:AGF>;?;F3F;A@5AEFE ;@5GDD76;@5A@@75F;A@I;F:3@K;@H7EF;93F;A@A8E;F75A@6;F;A@EAD3@K5>73@GBD7?76;3>D7?AH3>AD D7EFAD3F;A@IAD=D7CG;D764K3@K AH7D@?7@F3>GF:AD;FK #7EEADE:3>>47D7EBA@E;4>78AD3@6E:3>> BDA?BF>K5A@6G5F3@K;@H7EF;93F;A@3@6D7?76;3F;A@3ED7CG;D764K3@KBB>;534>7#3I3>>EB;>>EADAF:7D D7>73E7EA83@K 3L3D6AGE)G4EF3@57EFAF:77JF7@F@AF53GE764K#7EE77F:3F:3H7A55GDD76ADI:;5:?3K A55GDA@F:7'DAB7DFK *:;E)75F;A@ E:3>>EGDH;H7F:7F7D?;@3F;A@AD7JB;D3F;A@A8F:;E9D77?7@F 38:7&3(* 3 7@7D3>>K #7EEAD3@6#7EE77E:3>>735:?3;@F3;@F:7;@EGD3@575AH7D397EE7F8ADF: ;@=-.'.9;@8G>>8AD573@678875FF:DAG9:AGFF:7&BF;A@*7D?#73E7*7D?3@6F:DAG9:F:7(7?AH3> 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 3F7*7D?F:DAG9:;@EGD3@57BA>;5;7ED73EA@34>K3557BF34>7FAF:7AF:7D'3DFK 35:'3DFKGBA@D7CG7EF 4GF@AF?AD7F:3@FI;57;@3@KFI7>H7 ?A@F:B7D;A6E:3>>8GD@;E:5GDD7@F57DF;8;53F7E7H;67@5;@9F:3F F:75AH7D397D7CG;D76;E47;@9?3;@F3;@76 4-3;H7DA8)G4DA93F;A@ %AFI;F:EF3@6;@9 3@KF:;@9 FA F:7 5A@FD3DK 5A@F3;@76 :7D7;@735:'3DFK:7D74KI3;H7E3@KD;9:FA8D75AH7DK393;@EFF:7AF:7D8AD;@<GDKAD>AEEFAB7DEA@3> BDAB7DFK6G7FA:3L3D6E5AH7D764K;@EGD3@57A4F3;@76I;F:D7EB75FFAF:7'DAB7DFKAD'D7?;E7E;@5>G6;@9 F:7;?BDAH7?7@FE3@6;@EF3>>3F;A@EF:7D7A@ 'RFX6LJQ(QYHORSH,' )( % %$))&' ' .&'.1.9>&3)3)*23.9> 3 35:'3DFK3E;@67?@;FADE:3>>;@67?@;8K6787@63@6:A>6:3D?>7EEF:7AF:7D '3DFK3@6;FE88;>;3F7E3@6F:7;D7?B>AK77E3@6397@FE393;@EF3@68DA?3@K3@63>>>AEE>;34;>;FK63?397 5>3;?5AEF5:3D9767?3@6AD7JB7@E7;@5>G6;@9D73EA@34>73FFAD@7KEP877E3EE7DF764KF:;D6B3DF;7E8AD ;@<GDKAD673F:FA'7DEA@E;@5>G6;@97?B>AK77EA87;F:7D'3DFK3@6 ADB:KE;53>63?397FABDAB7DFK3D;E;@9 AGFA8AD;@5A@@75F;A@I;F:F:7@79>;97@F35FEADA?;EE;A@EADI;>>8G>?;E5A@6G5FA8F:7;@67?@;FADAD3 ?3F7D;3>4D735:A83@KA4>;93F;A@D7BD7E7@F3F;A@ADI3DD3@FKA8F:7;@67?@;FADG@67DF:;E9D77?7@F 7J57BFFAF:77JF7@F53GE764KF:7@79>;97@F35FEADA?;EE;A@EADI;>>8G>?;E5A@6G5FA8F:7;@67?@;8;76 B3DFK 4#7EE77E:3>>@AF47D7EBA@E;4>7FA#7EEADAD3@KF:;D6B3DFK8AD3@K5>3;?E5AEFE AD63?397E;@5>G6;@98;@7EADB7@3>F;7E3FFD;4GF34>7FA3@KH;A>3F;A@EA8BB>;534>7#3IE7J;EF;@9BD;ADFA F:7 8875F;H73F7AD4K3@KB3DFKAF:7DF:3@F:7#7EE77'3DF;7E 5*:;E)75F;A@ E:3>>EGDH;H7F:7F7D?;@3F;A@AD7JB;D3F;A@A8F:;E9D77?7@F &8:&19> >89*2488 3 @F:77H7@FF:7'D7?;E7EAD3557EEF:7D7FAE:3>>47EA63?3976AD67EFDAK764K 8;D7ADAF:7D53EG3>FKEA3EFA?3=7F:7GE7A8F:7'D7?;E7E;?BD35F;53>3E67F7D?;@764K#7EE77;@;FEEA>7 3@634EA>GF76;E5D7F;A@F:7@#7EE77?3K7>75FFAF7D?;@3F7F:;E9D77?7@F4KBDAH;6;@9@AF;57FA#7EEAD A8EG5:F7D?;@3F;A@I;F:;@@;@7FK 63KEA8#7EE77PE=@AI>7697A8F:763?397AD67EFDG5F;A@I:;5: F7D?;@3F;A@I;>>4778875F;H73EA8363F7A8EG5:63?397AD67EFDG5F;A@ 8#7EE776A7E@AF7>75FFAF7D?;@3F7 F:;E9D77?7@FI;F:;@@;@7FK 63KEA8EG5:353EG3>FKF:7@F:7(7@FE:3>>47343F76G@F;>EG5:F;?73E #7EE77PEGE7A8F:7'D7?;E7E;ED7EFAD76 8#7EE776A7E@AF7>75FFAF7D?;@3F7F:;E9D77?7@FBGDEG3@FFA F:7BD7H;AGEE7@F7@57E#7EEADE:3>>7J7D5;E75A??7D5;3>>KD73EA@34>7788ADFEFAD7B3;DF:763?397FAF:7 'D7?;E7E3@6D7FGD@F:7'D7?;E7EFA;FE5A@6;F;A@BD;ADFAEG5:63?397AD67EFDG5F;A@ F:3F7J57BF3EAF:7DI;E7BDAH;676;@F:;E9D77?7@F#7EEADE:3>>;@@A7H7@F47D7CG;D76FAD7B3;DD7B>357 ADD7EFAD73@KBDAB7DFKA8#7EE775A?BD;E;@9B3DFA8F:7)KEF7?EI:;5:D7B>357?7@FADD7EFAD3F;A@E:3>>47 #7EE77PED7EBA@E;4;>;FK 4 @F:77H7@FA83@K:3D?FAF:7)KEF7?F:3F;@F:7D73EA@34>7<G69?7@FA8#7EE77 D7EG>FE;@FAF3>63?39767EFDG5F;A@AD>AEEA8F:7)KEF7?M1+, &(++N#7EE77E:3>>I;F:;@FI7@FK GE;@7EE3KE8A>>AI;@9F:7A55GDD7@57A8EG5:)KEF7?#AEE@AF;8K#7EEADI:7F:7D#7EE77;EI;>>;@9 @AFI;F:EF3@6;@9EG5:)KEF7?#AEEFAD7B3;DADD7B>357F:7)KEF7?3@6FA5A@F;@G7F:;E9D77?7@F @F:7 7H7@FF:3F#7EE77@AF;8;7E#7EEADF:3F#7EE77;E@AFI;>>;@9FAD7B3;DADD7B>357F:7)KEF7?#7EE77?3K F7D?;@3F7F:;E9D77?7@F78875F;H7GBA@F:763F7A8EG5:)KEF7?#AEE3@6#7EE77E:3>>477@F;F>76FA3>> BDA5776EA8;FE;@EGD3@57BA>;5;7EI;F:D7EB75FFAF:7)KEF7?#AEE3@6#7EEADE:3>>BDA?BF>KD7FGD@FA#7EE77 F:7BADF;A@A8F:7BD7B3;6(7@F5AH7D;@9F:763KED7?3;@;@947FI77@F:763F7A8EG5:)KEF7?#AEE3@6F:7 @7JF3@@;H7DE3DKA8F:7A??7D5;3>&B7D3F;A@3F7 5 @F:77H7@FA8F7D?;@3F;A@G@67DF:;E)75F;A@ #7EE77E:3>>D7?AH7F:7)KEF7?E ;@355AD63@57I;F:)75F;A@5 4438*6:*39.&1&2&,*8%AFI;F:EF3@6;@93@KAF:7DBDAH;E;A@;@F:;E9D77?7@F @7;F:7D#7EE77@AD#7EEADE:3>>47>;34>7FAF:7AF:7D8AD3@K5A@E7CG7@F;3>BG@;F;H7AD;@6;D75F63?397E ;@5>G6;@9I;F:AGF>;?;F3F;A@>AEEA8GE7A8F:7;DBDAB7DFK>AEEA8BDA8;FE5AEFA853B;F3>AD;@5D73E76 AB7D3F;@95AEFE3D;E;@9AGFA8F:;E9D77?7@FI:7F:7D4KD73EA@A85A@FD35F;@67?@;FKEFD;5F>;34;>;FK @79>;97@57AD4D735:A8I3DD3@FK 43)*23&9.43'DA?BF>KGBA@D757;BFA8@AF;57F:3FF:7'D7?;E7EAD'DAB7DFK?3K47AD I;>>47FD3@E87DD76FA35A@67?@;@93GF:AD;FKBGDEG3@FFA3F3=;@9A83>>AD3BADF;A@A8F:7'DAB7DFK#7EEAD 'RFX6LJQ(QYHORSH,' )( % %$))&' ' E:3>>@AF;8K#7EE77A8E3?7 @F:77H7@FF:7'D7?;E7EAD'DAB7DFK3D7FD3@E87DD76FA35A@67?@;@93GF:AD;FK BGDEG3@FFA3F3=;@9A83>>AD3BADF;A@A8F:7'DAB7DFKEG88;5;7@F;@#7EE77PE67F7D?;@3F;A@FAD7@67DF:7 'D7?;E7EG@EG;F34>78AD#7EE77PEGE7ADFA@793F;H7>K;?B35FF:73557EEFAF:7'D7?;E7E#7EE77E:3>>:3H7 F:7D;9:FFAF7D?;@3F7F:;E9D77?7@F;??76;3F7>KGBA@@AF;57FA#7EEAD )3>7FA3BGD5:3E7DI;F:F:7 BAI7D A8 7?;@7@F 6A?3;@ ;@ F:7 8357 A8 F:7 7J7D5;E7 A8 F:7 BAI7D E:3>> 47 FD73F76 3E 3 F3=;@9 4K 5A@67?@3F;A@G@67DF:;E9D77?7@F @F:77H7@FA83@3I3D6D7>3F76FA7?;@7@F6A?3;@AD5A@67?@3F;A@ A83>>ADB3DFA8F:7'D7?;E7E735:'3DFKE:3>>477@F;F>76FAF3=78DA?EG5:3I3D6F:3FBADF;A@3E3>>AI76 4K>3I8AD;FED7EB75F;H7BDAB7DFK;@F7D7EF3BBDABD;3F763EI7>>3E3@K63?397EEG887D76F:7D74K 88.,32*39'>*88**&3).3&3(.3,&79>749*(9.438 3#7EE77E:3>>@AF3EE;9@ADEG4>73E73@KA8;FED;9:FE6GF;7EADA4>;93F;A@EG@67DF:;E 9D77?7@F I;F:AGF F:7 BD;AD 5A@E7@F A8 #7EEAD I:;5: 5A@E7@F E:3>> @AF 47 G@D73EA@34>K I;F::7>6 5A@6;F;A@76AD67>3K76 %AFI;F:EF3@6;@9F:78AD79A;@9#7EE77?3KI;F:AGF5A@E7@F8DA?#7EEAD3EE;9@ 3@KA8;FED;9:FE6GF;7EADA4>;93F;A@EG@67DF:;E9D77?7@F;FA3 ;@3@5;@9'3DFKBGDEG3@FFA)75F;A@ 5;;FAA@7AD?AD7A8;FE88;>;3F7E;;;FAA@7AD?AD7F:;D6B3DF;7E;@5A@@75F;A@I;F:35A>>3F7D3> 3EE;9@?7@FA8D;9:FE?ADF9397B>7697ADAF:7DI;E7;HFA3@K'7DEA@AD7@F;FKEG55776;@9FA3>>AD EG4EF3@F;3>>K3>>A8F:7EFA5=AD3EE7FEA8#7EE77ADHFA3EG557EEAD7@F;FK;@3?7D97DAD35CG;E;F;A@ FD3@E35F;A@ #7EEAD39D77EFA7J75GF73@K5A@E7@F@AH3F;A@ADAF:7D6A5G?7@F3F;A@F:3F#7EE77?3KD7CG7EF ;@5A@@75F;A@I;F:3@K3EE;9@?7@FB7D?;FF764KF:;E)75F;A@ ;@5>G6;@9I;F:AGF>;?;F3F;A@7@F7D;@9;@FA 35A@E7@F3@63EE;9@?7@F39D77?7@FI;F:#7EE77PE ;@3@5;@9'3DFK 4%AFI;F:EF3@6;@93@KF:;@9:7D7;@FAF:75A@FD3DK#7EE77?3K5A>>3F7D3>>K3EE;9@ F:;E9D77?7@F3@6F:7)KEF7?FA3 ;@3@5;@9'3DFKI;F:AGFF:7@7768AD5A@E7@F8DA?#7EEAD +BA@D757;BF A8@AF;57A8F:7@3?73@6366D7EEA83 ;@3@5;@9'3DFK#7EEAD39D77EFA67>;H7D3@K@AF;57EA86783G>FFA F:7 ;@3@5;@9'3DFKE;?G>F3@7AGE>KI;F:F:767>;H7DKA8EG5:@AF;57EA86783G>FFA#7EE77 *:7 ;@3@5;@9 '3DFKI;>>:3H7F:7D;9:F;@;FEEA>76;E5D7F;A@4GF@AFF:7A4>;93F;A@;FA7@8AD57;FE>;7@3@635CG;D7F;F>7 FA3>>AD3@KBADF;A@A8F:7)KEF7?3@63>>D;9:FF;F>73@6;@F7D7EFA8#7EE77;@3@6FAF:;E9D77?7@F4K3@K >3I8G>?73@E;;FAF3=7BAEE7EE;A@A83@6AB7D3F73>>AD3@KBADF;A@A8F:7)KEF7?3@6FAB7D8AD?3>> A4>;93F;A@EFA47B7D8AD?764K#7EE77G@67DF:;E9D77?7@FADFA53GE73D757;H7DFA473BBA;@F76FA6A EA;;;FA5GD73@K6783G>FEAD4D735:7E4K#7EE77I;F:;@F:7F;?7B7D;A6EBDAH;676:7D7G@67D8AD#7EE77 B>GE3@366;F;A@3>E;JFK 63KE;@F:753E7A83@ H7@FA8783G>FG@67D)75F;A@ 3@6;@AD67DFA EG55776FAF:7D;9:FE3@6A4>;93F;A@EA8#7EE77G@67DF:;E9D77?7@FE:3>>@AF47D7CG;D76FA5GD73@K 6783G>FE4K#7EE77G@67D)75F;A@ F:3F4KF:7;D@3FGD73D7@AF53B34>7A847;@95GD764KF:7 ;@3@5;@9 '3DFK @KEG5:@AF;57EE:3>>47E7@FFAF:7 ;@3@5;@9'3DFK3FF:7366D7EEEB75;8;76;@ID;F;@9FA#7EEAD4K #7EE77AD3@K ;@3@5;@9'3DFK 3;>GD74K#7EEADFA9;H7F:7 ;@3@5;@9'3DFKEG5:@AF;57E:3>>@AF6;?;@;E: F:7 ;@3@5;@9'3DFKPED;9:FE393;@EF#7EE774GFE:3>>BD7E7DH73>>D;9:FEA8F:7 ;@3@5;@9'3DFKFA5GD73@K 6783G>F3@6FAD7?AH73@KBDAB7DFKA8#7EE77>A53F76A@F:7'D7?;E7E 5 8#7EEAD:3E477@@AF;8;76A8F:77J;EF7@57A83 ;@3@5;@9'3DFK#7EEADI;>>@AF 39D77FA3@K3?7@6?7@F?A6;8;53F;A@ADHA>G@F3DKF7D?;@3F;A@A8F:;E9D77?7@FI;F:AGFF:7BD;ADID;FF7@ 5A@E7@FA8F:7 ;@3@5;@9'3DFK #7EEAD39D77EF:3FGBA@8AD75>AEGD7AD3EE;9@?7@F;@>;7GA88AD75>AEGD7 A8;FE?ADF9397ADE75GD;FK;@F7D7EF;@F:7)KEF7?F:7 ;@3@5;@9'3DFK?3KEG55776FAF:7D;9:FE3@6 A4>;93F;A@EA8#7EE77G@67DF:;E9D77?7@F3@6F:7D738F7DI;F:AGF#7EEADPE5A@E7@FFA3EE;9@ADFD3@E87D 3>>AD3@KBADF;A@A8F:7)KEF7?FA3F:;D6B3DFK *:7 ;@3@5;@9'3DFKI;>>47D7EBA@E;4>78ADB7D8AD?3@57 A8#7EE77PEA4>;93F;A@E38F7D;FEG55776EFA#7EE77PE;@F7D7EFEG@67DF:;E9D77?7@F4GFE:3>>:3H7@A8GDF:7D >;34;>;FK:7D7G@67D38F7D;F3EE;9@EEG5:;@F7D7EFEFA3F:;D6B3DFK 6 8F:;E9D77?7@F;ED7<75F76AD6;E388;D?764K#7EE77BGDEG3@FFA43@=DGBF5K>3I ADAF:7D>3I38875F;@95D76;FADPED;9:FE3@6I;F:;@@;@7FK 63KE38F7DEG5:7H7@F3@K ;@3@5;@9'3DFK E:3>>:3H73DD3@976FAF:7D73EA@34>7E3F;E835F;A@A8#7EEAD8ADB7D8AD?3@57A8#7EE77PEA4>;93F;A@EG@67D F:;E9D77?7@FF:7@#7EEADE:3>>7J75GF73@667>;H7DFAEG5: ;@3@5;@9'3DFKADFA367E;9@77A8EG5: ;@3@5;@9'3DFK3@7I39D77?7@FI:;5:;E:3>>478AD3F7D?7CG3>FAF:7D7?3;@67DA8F:7#73E7*7D? 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 478AD79;H;@978875FFAEG5:D7<75F;A@ADF7D?;@3F;A@3@6;;E:3>>5A@F3;@F:7E3?75AH7@3@FE39D77?7@FE F7D?EBDAH;E;A@E3@6>;?;F3F;A@E3EF:;E9D77?7@F 7@3EE;9@?7@F4K7;F:7D'3DFK;@355AD63@57I;F:F:;E)75F;A@ E:3>>BDAH;676 F:3F3EE;9@773EEG?7EF:73EE;9@ADPEA4>;93F;A@EG@67DF:;E9D77?7@FD7>;7H7F:73EE;9@ADA8;FEA4>;93F;A@E :7D7G@67D7J57BFI;F:D7EB75FFAG@6;EBGF76B3K?7@FE6G74KF:73EE;9@AD3EA8F:778875F;H763F7A8F:7 3EE;9@?7@FI:;5:A4>;93F;A@EE:3>>47B7D8AD?764K3EE;9@ADAD3EE;9@773E35A@6;F;A@BD75767@FFAEG5: 3EE;9@?7@F 8*:7 BDAH;E;A@E A8 F:;E )75F;A@ E:3>> EGDH;H7 F:7 F7D?;@3F;A@ D7<75F;A@ AD 6;E388;D?3F;A@A8F:;E9D77?7@F3@6E:3>>5A@F;@G7;@8G>>8AD573@678875FF:7D738F7DFAF:7E3?77JF7@F3E ;8F:;E)75F;A@ I7D73E7B3D3F73@6;@67B7@67@F5A@FD35F?3674K#7EEAD#7EE773@6735: ;@3@5;@9 '3DFK #7EE77PE ;@3@5;@9'3DF;7EE:3>>477JBD7EEF:;D6B3DFK47@78;5;3D;7EA8F:;E)75F;A@ *+&:198&3)*2*).*8 3 H7@FEA8783G>F *:7A55GDD7@57A83@KA8F:78A>>AI;@9735:3@M . ',( -%,NE:3>>B>357F:7'3DFKD7EBA@E;4>78ADF:7 H7@FA8783G>FF:7M -%,"' *,1N;@6783G>FA8 F:;E9D77?7@F3@6F:7AF:7D'3DFKF:7M(' -%,"' *,1NE:3>>477@F;F>76FAF:7D7?76;7EBDAH;676 ;@)75F;A@ 4;3'3DFKPE83;>GD7FAB3K3@K3?AG@FD7CG;D76FA47B3;6:7D7G@67D3@6EG5:83;>GD7E:3>> 5A@F;@G78ADF:;DFK 63KE38F7DID;FF7@@AF;57A8EG5:83;>GD7:3E477@D757;H764KF:7783G>F;@9'3DFK ;;3'3DFKPE83;>GD7FAB7D8AD?3@K5AH7@3@FADA4>;93F;A@E:7D7G@67DAF:7DF:3@B3K?7@FA8?A@7F3DK EG?EAD5A??;F?7@FA83?3F7D;3>4D735:A8F:;E9D77?7@F3@6F:783;>GD7FA5GD7EG5:6783G>FI;F:;@ E;JFK 63KE38F7DID;FF7@@AF;57EB75;8K;@9EG5:83;>GD7:3E477@D757;H764KF:7783G>F;@9'3DFKAD ;;;;8F:7@3FGD7AD7JF7@FA8F:7A4>;93F;A@ADA4>;93F;A@E;EEG5:F:3F?AD7F:3@E;JFK 63KE3D7D7CG;D76 FA5A?B>7F7F:75GD73'3DFKPE83;>GD7FAGE76;>;97@573@69AA683;F:FA5A??7@573@65A@F;@G77J7D5;E;@9 5A??7D5;3>>KD73EA@34>76;>;97@57FA5GD7F:7 H7@FA8783G>F38F7DEG5:E;JFK 63KB7D;A63@6;H3 '3DFK475A?7EEG4<75FFA33@=DGBF5K H7@F GDF:7D;8F:7'3DF;7E:3H739AA683;F:6;EBGF73EFAI:7F:7D 3B3K?7@F;E6G7:7D7G@67DF:73>>79766783G>F;@9'3DFK?3K67BAE;FF:73?AG@F;@5A@FDAH7DEK;@7E5DAI I;F:3@KD7BGF34>7F:;D6B3DFK7E5DAIAD?3K;@F7DB>736F:7E3?7I:;5:3?AG@FE:3>>D7?3;@G@6;EFD;4GF76 3@6E:3>>@AF355DG7;@F7D7EFADB7@3>F;7E3@6@A H7@FA8783G>FE:3>>47677?76FA:3H7A55GDD76G@F;> 8;@3>675;E;A@4K35AGDFA85A?B7F7@F<GD;E6;5F;A@ADGBA@39D77?7@F4KF:7'3DF;7E %AEG5:67BAE;FE:3>> 5A@EF;FGF73I3;H7DA8F:7783G>F;@9'3DFKPED;9:FFA;@EF;FGF7>793>35F;A@8ADD75AH7DKA8EG5:3?AG@FE 4(7?76;7E J57BF3ECG3>;8;764K)75F;A@ 4GBA@F:7A55GDD7@57A83@6 6GD;@9F:75A@F;@G3@57A83@ H7@FA8783G>FF:7%A@783G>F;@9'3DFKE:3>>;:3H7F:7D;9:FFAF7D?;@3F7 F:;E9D77?7@F4K9;H;@9ID;FF7@@AF;57A8F7D?;@3F;A@FAF:7783G>F;@9'3DFK3@6;;:3H73>>D;9:FE3@6 D7?76;7EF:3F?3K473H3;>34>7FAF:7%A@783G>F;@9'3DFK3F>3IAD;@7CG;FK 49.(*8 >>@AF;57EG@67DF:;E9D77?7@FE:3>>47?367;@ID;F;@9FAF:766D7EE7E8AD %AF;57EEB75;8;76A@F:7AH7D):77F %AF;57EE:3>>4767>;H7D764K:3@667>;H7DKD79G>3DAH7D@;9:F 67>;H7DKE7DH;57D79;EF7D76AD57DF;8;76?3;>D7FGD@D757;BFD7CG7EF76AD7?3;> ?3;>@AF;57EE:3>>D7CG;D7 5A@8;D?3F;A@A8D757;BF %AF;57EE:3>>47677?76FA:3H7477@D757;H76I:7@67>;H7D763EE:AI@A@F:7 D75AD6EAD?3@;87EFA8EG5:5AGD;7D67>;H7DKE7DH;57ADF:7+ ) 'AEF3>)7DH;57 (7<75F;A@ADD78GE3>FA 3557BF67>;H7DKA83@K@AF;57E:3>>47677?76FA47F:77CG;H3>7@FA8D757;BFA83@K@AF;579;H7@:7D7G@67D '3DFK?3K5:3@97;FE366D7EE4KBDAH;6;@9ID;FF7@@AF;57A8F:7E3?7;@355AD63@57I;F:F:7BDAH;E;A@E A8F:;E)75F;A@ 3;>GD7FA5A?B>KEFD;5F>KI;F:F:7F7D?EA8F:;EBDAH;E;A@E:3>>@AF47:7>6393;@EFF:7 '3DFK5>3;?;@9FA:3H79;H7@@AF;57EA>A@93EEG5:'3DFKEG4EF3@F;3>>K5A?B>;76I;F:F:;EBDAH;E;A@3@6 53@67?A@EFD3F7F:3FF:7@AF;57;@CG7EF;A@I3ED757;H76 &.;*7 *:7I3;H7D4K7;F:7D'3DFKA83@K4D735:A83@KF7D?5A@6;F;A@ADBDAH;E;A@ :7D7;@5A@F3;@76E:3>>@AF47677?76FA473I3;H7DA83@KEG4E7CG7@F4D735:A8EG5:F7D?5A@6;F;A@AD BDAH;E;A@AD3@KAF:7DF7D?5A@6;F;A@ADBDAH;E;A@5A@F3;@76:7D7;@ 'RFX6LJQ(QYHORSH,' )( % %$))&' ' *2*).*8:2:1&9.;* %AD7?76K:7D7;@5A@87DD76GBA@ADD7E7DH76FA#7EE77AD#7EEAD E:3>>7J5>G673@KAF:7DD7?76K:7D7;@AD4K>3IAD;@7CG;FKAD4KEF3FGF7BDAH;6764GF735:E:3>>47 5G?G>3F;H73@6;@366;F;A@FA7H7DKAF:7DD7?76K9;H7@:7D7G@67DAD@AIAD:7D738F7D7J;EF;@93F>3IAD;@ 7CG;FKAD4KEF3FGF7 *&).3,8 *:7 :736;@9E ;@ F:;E 9D77?7@F 3D7 EA>7>K 8AD 5A@H7@;7@57 3@6 73E7 A8 D787D7@573@6E:3>>:3H7@A78875F;@;@F7DBD7F;@9F:7?73@;@9A83@KBDAH;E;A@A8F:;E9D77?7@F 3;&1.) *72 83@KBDAH;E;A@A8F:;E9D77?7@F;E675>3D76AD67F7D?;@764K3@K5AGDF A85A?B7F7@F<GD;E6;5F;A@FA47;>>793>;@H3>;6ADG@7@8AD5734>7F:7>793>;FKH3>;6;FKAD7@8AD5734;>;FKA8 F:7D7?3;@;@9B3DFEF7D?E3@6BDAH;E;A@EE:3>>@AF4738875F76F:7D74K3@6E3;6;>>793>G@7@8AD5734>7AD ;@H3>;6B3DFF7D?ADBDAH;E;A@I;>>47677?76@AFFA473B3DFA8F:;E9D77?7@F F:3F F:7'3DF;7EE:3>>IAD=FA97F:7D;@9AA683;F:FA?A6;8KF:;E9D77?7@F3E@757EE3DKFAD7F3;@F:7;@F7@FA8 3@KEG5:E7H7D765>3GE7 -4.(*4+&< *:;E9D77?7@FE:3>>475A@EFDG76;@355AD63@57I;F:F:7>3IEA8F:7 )F3F7A8 >>;@A;EI;F:AGFD793D6FA;FE5A@8>;5FA8>3IBD;@5;B>7E .85:9**841:9.43 @F:77H7@FF:3FF:7D7;E3@K5A@FDAH7DEK5>3;?AD6;EBGF747FI77@ F:7'3DF;7E:7D7FA3D;E;@9AGFA8ADD7>3F76FAF:;E9D77?7@FADF:74D735::7D7A8F:7'3DF;7E39D77FA 7@9397;@9AA683;F:@79AF;3F;A@EFAD7EA>H7EG5:6;EBGF7 8F:7'3DF;7E3D7G@34>7FAD7EA>H7EG5:6;EBGF7 F:DAG9:EG5:@79AF;3F;A@E7;F:7D'3DFK?3KI;F:;@3D73EA@34>7F;?738F7DF:76;EBGF7:3E3D;E7@BGDEG7 3>>3H3;>34>7>793>3@6 AD7CG;F34>7D7?76;7E 99473*>@8**8 @F:77H7@FF:7D7;E3>3IEG;F35F;A@3D4;FD3F;A@ADAF:7DBDA5776;@9 47FI77@#7EE773@6#7EEADI:;5:3D;E7E8DA?AD5A@57D@EF:;E9D77?7@FI:7F:7DF:3F>3IEG;F35F;A@ 3D4;FD3F;A@ADAF:7DBDA5776;@9;@HA>H7E53GE7EA835F;A@;@5A@FD35FAD;@FADF3F>3IAD;@7CG;FKF:7 EG4EF3@F;3>>K BD7H3;>;@9 B3DFK E:3>> 47 7@F;F>76 FA D75AH7D 3>> 5AEFE 3@6 7JB7@E7E ;@5>G6;@9 ;FE 35FG3> 3FFAD@7KEP3@67JB7DFAD5A@EG>F3@FEP877E3@65AGDF5AEFE;@EG5:>3IEG;F35F;A@3D4;FD3F;A@ADAF:7D BDA5776;@9 &.;*74+:7> 7.&1 *&* .* %*' ($ ** / #- '(*/ ( / (( ,&#/- , ) *)( )' * , ( *)*&!+(/*( #& %/# $ &(+) & * &% %%/&+(* %%/!+( ) * &%) +'&%&(( ) % &+* & &(( #* % *&* ) ( $ %* .3).3,++*(9 *:;E9D77?7@F3@6;FED;9:FEBD;H;>797E6GF;7E3@6A4>;93F;A@EE:3>> 4;@63@6;@GD7FAF:747@78;FA83@6474;@6;@9GBA@735:A8F:7'3DF;7E:7D7FAFA97F:7DI;F:F:7;DD7EB75F;H7 :7;DEB7DEA@3>D7BD7E7@F3F;H7EEG557EEADE3@6B7D?;FF763EE;9@E 4:39*75&798 *:;E9D77?7@F?3K477J75GF76;@3@K@G?47DA85AG@F7DB3DFEI:;5: E:3>>FA97F:7D5A@EF;FGF7A@73@6F:7E3?739D77?7@F 35:'3DFK39D77EF:3FE;9@3FGD7EFD3@E?;FF764K 835E;?;>7AD7>75FDA@;53>>KE:3>>47>793>3@64;@6;@93@6:3H7F:7E3?78G>>8AD573@678875F3E;83@AD;9;@3> A8F:;E9D77?7@F3@6:36477@67>;H7D763@6:7D74KI3;H73@K6787@E7EFAF:77@8AD57?7@FA8F:7F7D?E A8F:;E9D77?7@F43E76A@F:78AD79A;@98AD?EA8E;9@3FGD7 39.7* ,7**2*39 *:;E9D77?7@F;@5>G6;@9F:7AH7D):77F3@63>>7J:;4;FED7BD7E7@FE F:78G>>3@65A?B>7F739D77?7@F47FI77@F:7'3DF;7E:7D7FAI;F:D7EB75FFAF:7EG4<75F?3FF7D5A@F3;@76 :7D7;@3@6F:7D7;@3@6EGB7DE767E3>>BD;ADID;FF7@ADAD3>@79AF;3F;A@ED7BD7E7@F3F;A@E5A??G@;53F;A@E 3@639D77?7@FE47FI77@E3;6B3DF;7EI;F:D7EB75FFAE3;6EG4<75F?3FF7D *:;E9D77?7@F?3K473?7@676 A@>K;@ID;F;@9E;9@764K4AF:#7EE773@6#7EEADADF:7;DD7EB75F;H7EG557EEADE;@;@F7D7EF #7EEAD3@6 #7EE77735:35=@AI>7697F:3F;@7J75GF;@9F:;E9D77?7@FF:3F'3DFK:3E@AFD7>;76A@3@KH7D43>ADID;FF7@ G@67DEF3@6;@9BDA?;E7ADD7BD7E7@F3F;A@I:;5:6A7E@AF3BB73D;@F:;E6A5G?7@F ,7.(:19:7&125&(9.9.,&9.43 ,7**2*39*:;E9D77?7@F6A7E@AF;@5ADBAD3F73@K BDAH;E;A@8DA?3@K39D;5G>FGD3>;?B35F?;F;93F;A@39D77?7@FF:3F?3K477@F7D76;@FAI;F:F:7 >>;@A;E 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 7B3DF?7@FA89D;5G>FGD7I;F:D7EB75FFAF:7'D7?;E7E3@M N *:7'3DF;7EEB75;8;53>>K39D77F:3F I;F:D7EB75FFA3@KBDAH;E;A@5A@F3;@76;@3@ $F:;E9D77?7@FE:3>>5A@FDA>I:7F:7DEG5:BDAH;E;A@ ;E366D7EE7697@7D3>>KEB75;8;53>>KAD@AF3F3>>;@F:;E9D77?7@F :79-*7 88:7&3(*8 +BA@F:7D757;BFA83D7CG7EF8DA?F:7AF:7D'3DFKAD3 ;@3@5;@9 '3DFK 735: '3DFK E:3>> 7J75GF7 EG5: 5A??7D5;3>>K D73EA@34>7 366;F;A@3> 6A5G?7@FE ;@EFDG?7@FE 3@6 3EEGD3@57E3@6F3=7EG5:366;F;A@3>35F;A@E3E3D7D73EA@34>K@757EE3DKFA53DDKAGFF:7F7D?E3@6;@F7@F :7D7A8;@5>G6;@93FF:7D7CG7EF;@9'3DFKPE7JB7@E77@F7D;@9;@FA3@K5A@E7@FE3EE;9@?7@FE388;63H;FE 7EFABB7>E3@6AF:7D6A5G?7@FE3E?3K47D73EA@34>KD7CG;D764KEG5:'3DFKPE>7@67DFA5D73F7B7D875FAD BD7E7DH7;FE5A>>3F7D3>;@F7D7EF;@EG5:'3DFKPEBDAB7DFKADEG5:B3DFKPED;9:FE3@6A4>;93F;A@EG@67DF:;E 9D77?7@F @K7EFABB7>E:3>>477J75GF76I;F:;@F7@ 63KEA83D7CG7EFF:7D78AD %7;F:7D'3DFKE:3>> G@D73EA@34>KI;F::A>65A@6;F;A@AD67>3K;FE5A?B>;3@57I;F:3@KD73EA@34>7D7CG7EF?367BGDEG3@FFA F:;E)75F;A@ 47(*&/*:7* J57BF3EAF:7DI;E7EB75;8;53>>KBDAH;676;@F:;E9D77?7@F@7;F:7D '3DFKE:3>>475A@E;67D76;@4D735:A8F:;E9D77?7@FAD>;34>78AD3@K67>3KAD83;>GD7FA5A?B>KI;F:F:;E 9D77?7@F;83@6FAF:77JF7@FF:3FEG5:67>3KAD83;>GD7;E3FFD;4GF34>7FAF:7A55GDD7@57A83 AD57$3<7GD7 H7@FBDAH;676F:3FF:7'3DFK5>3;?;@9D7>;78G@67DF:;E)75F;A@E:3>>;??76;3F7>K;@AF;8KF:7AF:7D '3DFK;@ID;F;@9A8F:77J;EF7@57A8F:7 AD57$3<7GD7 H7@F;;7J7D5;E73>>D73EA@34>7788ADFE@757EE3DK FA?;@;?;L767>3K53GE764KEG5: AD57$3<7GD7 H7@F;;;@AF;8KF:7AF:7D'3DFK;@ID;F;@9A8F:757EE3F;A@ ADF7D?;@3F;A@A8E3;6 AD57$3<7GD7 H7@F3@6;HD7EG?7B7D8AD?3@57A8;FEA4>;93F;A@E:7D7G@67D3E EAA@3EBD35F;534>7F:7D738F7D 83 AD57$3<7GD7 H7@FE:3>>:3H7A55GDD76F:3F:3EBD7H7@F767;F:7D'3DFK 8DA?B7D8AD?;@93@KA8;FE?3F7D;3>A4>;93F;A@E:7D7G@67D3@6F:3F:3E5A@F;@G768AD35A@F;@GAGEB7D;A6 A8A@7:G@6D76FI7@FK 63KEF:7@7;F:7D'3DFKE:3>>:3H7F:7D;9:F4GF@AFF:7A4>;93F;A@FAF7D?;@3F7 F:79D77?7@FGBA@@;@7FK 63KEPBD;AD@AF;57FAF:7AF:7D'3DFKI;F:AGFB7@3>FKAD8GDF:7D>;34;>;FK 8 3FF:77@6A8EG5:@;@7FK 63KB7D;A6EG5: AD57$3<7GD7 H7@FE:3>>EF;>>5A@F;@G73@6F:7?3F7D;3> A4>;93F;A@ :3E @AF 477@ 34>7 FA 47 D7EG?76 FA F:7 D73EA@34>7 E3F;E835F;A@ A8 F:7 38875F76 '3DFK F:7 9D77?7@FE:3>>F7D?;@3F7 +BA@EG5:F7D?;@3F;A@6G7FA3 AD57$3<7GD7 H7@F@7;F:7D'3DFKE:3>>:3H7 3@K>;34;>;FKFAF:7AF:7DAF:7DF:3@3@KEG5:>;34;>;F;7EF:3F:3H7355DG76BD;ADFAEG5:F7D?;@3F;A@ADF:AE7 I:;5:7JBD7EE>KEGDH;H7F:7F7D?;@3F;A@AD7JB;D3F;A@A8F:79D77?7@FBGDEG3@FFAF:7F7D?E:7D7A8 8 3FF:77@6A8EG5:@;@7FK 63KB7D;A6EG5: AD57$3<7GD7 H7@F;E@A>A@97D5A@F;@G;@9F:79D77?7@F E:3>>D7?3;@;@8G>>8AD573@678875F3@6F:7'3DFKPEF7D?;@3F;A@@AF;57E:3>>47677?76FA:3H7477@ I;F:6D3I@ (7@FE:3>>343F78AD3@KB7D;A66GD;@9I:;5:#7EE77;E@AF34>7FAAB7D3F7F:7)KEF7?;@F:7 ?3@@7D5A@F7?B>3F76:7D7;@ 43+.)*39.&1.9>#7EEADI;>>?3;@F3;@;@EFD;5F5A@8;67@578ADF:7EA>747@78;FA8#7EE77 F:77J;EF7@573@6F:7F7D?EA8F:;E9D77?7@F3@6F:7FD3@E35F;A@E5A@F7?B>3F76:7D7;@;@5>G6;@94GF@AF >;?;F76FA3@K4GE;@7EEB>3@E8;@3@5;3>;@8AD?3F;A@F75:@;53>;@8AD?3F;A@D793D6;@9F:767E;9@AB7D3F;A@ ?3;@F7@3@57A8F:7)KEF7? #7EEAD?3K6;E5>AE7F:;E9D77?7@F3@6F:7FD3@E35F;A@E 5A@F7?B>3F76 :7D7;@ FA #7EEADPE 388;>;3F7E EG4E;6;3D;7E 3FFAD@7KE 5A@EG>F3@FE AD AF:7D 397@FE AD BDA87EE;A@3>36H;EADEAD3ED7CG;D764K>3I *247&3):2 4+ *&8* #7EEAD 39D77E FA 5AAB7D3F7 I;F: #7EE77 ;@ 7J75GF;@9 3@K 6A5G?7@FE@757EE3DKFABDAF75F#7EE77PED;9:FE;@ADGE7A8F:7'D7?;E7E $7?AD3@6G?A8#73E7;@ EG4EF3@F;3>>KF:78AD?3FF35:76:7D7FA3E=-.'.9E:3>>47D75AD676;@F:7A88;57I:7D7D73>7EF3F7D75AD6E 3D75GEFA?3D;>K8;>76;@F:7<GD;E6;5F;A@A8F:7'D7?;E7E 740*78 @F:77H7@F3@K4DA=7DADAF:7DB3DFK5>3;?E35A??;EE;A@F:7'3DFKD7EBA@E;4>7 8ADF:75A@F35FI;F:F:3F5>3;?3@FE:3>>;@67?@;8K6787@63@6:A>6F:7AF:7D'3DFK:3D?>7EE8DA?F:3F5>3;? 3@6;@5>G6;@9I;F:AGF>;?;F3F;A@F:7B3K?7@FA83@K3FFAD@7KEP877E3@65AEFE;@5GDD76 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 39*757*9&9.43 *:;E 9D77?7@F E:3>> @AF 47 5A@EFDG76 393;@EF F:7 '7DEA@ AD 7@F;FK BD7B3D;@9;F4GFE:3>>475A@EFDG763E;83>>A8F:7'3DF;7E<A;@F>KBD7B3D76F:;E9D77?7@FI;F:AGF3@K G@57DF3;@FKAD3?4;9G;FK47;@9;@F7DBD7F76393;@EF3@KA@7A8F:7? 4&793*78-.5 *:;E9D77?7@F;E@AF;@F7@6763@6E:3>>@AF475A@EFDG76FA5D73F73@K B3DF@7DE:;BAD<A;@FH7@FGD7AD3@KAF:7DD7>3F;A@E:;BAF:7DF:3@A@7A8O>7EEADP3@6O>7EE77P3@6O9D3@FADP 3@6O9D3@F77P3@6@7;F:7D'3DFKE:3>>47677?76F:7397@FA8F:7AF:7D'3DFK@AD:3H7F:73GF:AD;FKFA35F 3E397@F8ADF:7AF:7D'3DFKAF:7DF:3@3EBDAH;676;@)75F;A@6 :'1.(++.(.&18 #7EEAD35=@AI>7697EF:3F;FED757;BFA8?A@7F3DK3@6AF:7D9AA63@6 H3>G34>7 5A@E;67D3F;A@ :7D7G@67D ?3K D7BD7E7@F 3 5A@8>;5F A8 ;@F7D7EF ;8 #7EEAD AD ;FE 88;>;3F7 ;E 3 9AH7D@?7@F7?B>AK77ADAF:7DI;E7E7DH7EA@39AH7D@?7@F3>7@F;FKI;F:675;E;A@?3=;@93GF:AD;FK3 M-%" " "%N3EFA3@KD;9:FE#7EE77?3KE77=AD3EFA3@KA4>;93F;A@EF:3F?3K47;?BAE76GBA@ #7EE77;@AD67DFA67H7>AB3@6 ADAB7D3F7F:7)KEF7?EM . %()& '," !,+N3@6#7EEAD:7D74K39D77E 8AD;FE7>83@6;FE88;>;3F7EFA D75GE7:;? :7DE7>88DA?3>>EG5:675;E;A@ED7>3F76FA#7EE77PE7H7>AB?7@F (;9:FEG@>7EEEG5:D75GE3>;EBDA:;4;F764K>3IAD;E@AFD73EA@34>KBD35F;534>75A@E;67D;@9F:7A4>;93F;A@E A8EG5:'G4>;5&88;5;3>PEBAE;F;A@3@6 D75GE7:;? :7DE7>88DA?3>>EG5:675;E;A@ED7>3F76FA#7EE77PE 7H7>AB?7@F(;9:FE;8EG5:D75GE3>;ED7CG;D764K>3I 8#7EEAD;E@AFD7CG;D76BGDEG3@FFA AD 34AH7 FAD75GE7:;? :7DE7>88DA?3675;E;A@D7>3F76FA#7EE77PE7H7>AB?7@F(;9:FE#7EEADI;>>;@36H3@57A8 3@KHAF7ADAF:7DA88;5;3>35F;A@A@F:77H7>AB?7@F(;9:FE6;E5>AE7F:77J;EF7@57A8F:;E9D77?7@F4GF @AFF:78;@3@5;3>F7D?EF:7D7;@3F3@AB7@?77F;@9A8F:7D7>7H3@F9AH7D@?7@F3>7@F;FK#7EEADE7DH7EA@3E 3'G4>;5&88;5;3> 66;F;A@3>>K;8#7EEAD;E3'G4>;5&88;5;3>3@63@KA8#7EEADPEEBAGE75:;>6ADAF:7D 67B7@67@F:3E38;@3@5;3>;@F7D7EF;@F:7)KEF7?E#7EEADE:3>>6;E5>AE7EG5:D7>3F;A@E:;B4GF@AFF:7 8;@3@5;3>F7D?EF:7D7A83F3@AB7@?77F;@9A8F:7D7>7H3@F9AH7D@?7@F3>7@F;FK#7EEADE7DH7EA@3E3'G4>;5 &88;5;3>BD;ADFAB3DF;5;B3F;A@;@3@K675;E;A@D7>3F76FA#7EE77PE7H7>AB?7@F(;9:FE .2*.84+9-*88*3(* *;?7;EA8F:77EE7@57I;F:D7EB75FFA3>>BDAH;E;A@EI;F:;@F:;E 9D77?7@F 41)4;*7 @F:77H7@FF:3F#7EE77E:3>>D7?3;@;@BAEE7EE;A@38F7DF:77JB;D3F;A@A8F:7 #73E7*7D?#7EE77E:3>>475A@E;67D763:A>6AH7D8DA??A@F:FA?A@F:A@>KA@F:7E3?7F7D?E3@6 5A@6;F;A@EE7F8ADF:;@F:;E9D77?7@F7J57BF3F F;?7EF:7?A@F:>KD7@F;@78875F3FF:77JB;D3F;A@A8 F:;E9D77?7@F3@6#7EEADE:3>>@AFI3;H73@KD;9:FEI:3FEA7H7DI:;5:;F:3E8ADF:7D7?AH3>A8#7EE77 38F7DF:77JB;D3F;A@ADF7D?;@3F;A@A8F:79D77?7@F 3 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 0) ' & # 1 F:7'3DF;7E:3H77J75GF76F:;E9D77?7@FA@F:7 8875F;H73F7 22222222222222222222222222222222222 (A47DF$ >678A@E3#A8FGE#;H;@9*DGEF *DGEF77(A47DF$ #A8FGE 22222222222222222222222222222222222 (A47DF$ >678A@E3#A8FGE#;H;@9*DGEF *DGEF77 >678A@E3#A8FGE &*1&<&7*1.2.9*)1.&'.1.9>(425&3> K2222222222222222222222222222222 %3?722222222222222222222222222222 *;F>7222222222222222222222222222222 'RFX6LJQ(QYHORSH,' )( % %$))&' ' ! " AD#7EEADPEF;F>7FAF:7'DAB7DFKD787D7@57;E:7D7;@?367FAF:78A>>AI;@9776E 77663F76 74DG3DK 3@6D75AD676A@ 74DG3DK ;@F:7"7@63>>AG@FK(75AD67DPE&88;57 ;@A5G?7@F%A 77663F76 74DG3DK 3@6D75AD676A@ 74DG3DK ;@F:7"7@63>>AG@FK(75AD67DPE&88;57 ;@A5G?7@F%A 77663F76 74DG3DK 3@6D75AD676A@ 74DG3DK ;@F:7"7@63>>AG@FK(75AD67DPE&88;57 ;@A5G?7@F%A 'RFX6LJQ(QYHORSH,' )( % %$))&' ' ! *:7'D7?;E7E5A@E;EFEA83BBDAJ;?3F7>K 35D7E >A53F76 3F F:7 'DAB7DFK 3E 67E5D;476 3@6 AD 67B;5F76 47>AI #7EEAD39D77EF:3FF:767E5D;BF;A@A8F:7'D7?;E7E I;>>47D7B>3576I;F:35FG3>?7F7E3@64AG@6EGBA@ 5A?B>7F;A@A8)KEF7?67E;9@3@6E;F7EGDH7K 'RFX6LJQ(QYHORSH,' )( % %$))&' ' ! M' ('& ',(," N:3EF:7?73@;@9E7F8ADF:;@)75F;A@5A8F:;E9D77?7@F M ++ + & ',N:3EF:7?73@;@9E7F8ADF:;@)75F;A@5 M "%", N?73@E3EFA3@K'7DEA@3@KAF:7D'7DEA@F:3F6;D75F>KAD;@6;D75F>K;E;@5A@FDA>A8;E5A@FDA>>76 4KAD;EG@67D5A??A@5A@FDA>I;F:EG5:'7DEA@AD;E36;D75FADA88;57DAD?7?47DA8EG5:'7DEA@ADA83@ 88;>;3F7A8EG5:'7DEA@ M * & ',N:3EF:7?73@;@9E7F8ADF:A@B397 :7D7;@ M))%" % /N?73@EI;F:D7EB75FFA3@K'7DEA@3@K5A@EF;FGF;A@3>BDAH;E;A@>3IEF3FGF7DG>7 D79G>3F;A@AD6;@3@57FD73FKAD67D675D77<G69?7@F675;E;A@57DF;8;53F7:A>6;@9;@<G@5F;A@D79;EFD3F;A@ >;57@E78D3@5:;E7B7D?;F3GF:AD;L3F;A@9G;67>;@7 AH7D@?7@F3>BBDAH3> @H;DA@?7@F3>#3I5A@E7@F AD D7CG;D7?7@F A8 3@K AH7D@?7@F3> GF:AD;FK :3H;@9 <GD;E6;5F;A@ AH7D EG5: '7DEA@ AD ;FE BDAB7DFK 7@8AD5734>7 3F >3I AD ;@ 7CG;FK ;@5>G6;@9 F:7 ;@F7DBD7F3F;A@ 3@6 36?;@;EFD3F;A@ F:7D7A8 4K EG5: AH7D@?7@F3>GF:AD;FK M-,!(*"2,"(' ,, *N:3EF:7?73@;@9E7F8ADF:;@)75F;A@6A8F:;E9D77?7@F M'$*-), 1 . ',N?73@EI;F:D7EB75FFA3'3DFKF:3F7;F:7DEG5:'3DFK:3E3BB>;768ADAD5A@E7@F76 FAF:73BBA;@F?7@FA8ADF:7F3=;@9A8BAEE7EE;A@4K3D757;H7D5GEFA6;3@FDGEF77AD>;CG;63FADA8;FE7>8AD A83>>ADEG4EF3@F;3>>K3>>A8;FEBDAB7DFK?367397@7D3>3EE;9@?7@F8ADF:747@78;FA8;FE5D76;FADE 5A??7@5763HA>G@F3DK53E7G@67D3@K43@=DGBF5K>3I8;>763B7F;F;A@E77=;@9FAF3=736H3@F397A8 3@K AF:7D >3I D7>3F;@9 FA 43@=DGBF5K ;@EA>H7@5K D7AD93@;L3F;A@ I;@6;@9 GB AD 5A?BAE;F;A@ AD D736<GEF?7@FA8674FEAD F3=7@3@K5ADBAD3F7ADAF:7D35F;A@8ADF:7BGDBAE7A878875F;@93@KA8F:7 8AD79A;@9AD3BDA5776;@9AD53E7:3E477@5A??7@576I;F:AGFF:73BB>;53F;A@AD5A@E7@FA8EG5:'3DFK ;@3@K5AGDFA85A?B7F7@F<GD;E6;5F;A@E77=;@9;;FE>;CG;63F;A@D7AD93@;L3F;A@6;EEA>GF;A@ADI;@6;@9GB ADF:75A?BAE;F;A@ADD736<GEF?7@FA8674FEAD;;F:73BBA;@F?7@FA83FDGEF77D757;H7D5GEFA6;3@ >;CG;63FADADF:7>;=7A8EG5:'3DFKG@67D3@K43@=DGBF5K>3I3@6EG5:BDA5776;@9AD53E7:3E5A@F;@G76 G@6787@676AD3@KAD67D<G69?7@FAD675D773BBDAH;@9ADAD67D;@93@KA8F:78AD79A;@9E:3>>477@F7D76 3@65A@F;@G7G@EF3K763@6;@78875F8AD3B7D;A6A8?AD7F:3@A@7:G@6D767;9:FK 63KE M-+"' ++1N?73@E3@K63KAF:7DF:3@)3FGD63K)G@63KAD3@KAF:7D63KA@I:;5:43@=;@9;@EF;FGF;A@E ;@F:7EF3F7I:7D7F:7'DAB7DFK;E>A53F763D7D7CG;D76AD3GF:AD;L764KBB>;534>7#3IFA475>AE768AD 4GE;@7EE M(&& * "%) *,"(', N?73@EF:763F7A@I:;5:F:7)KEF7?E5A??7@57EE7>>;@97>75FD;5;FKFA3 F:;D6B3DFKBGD5:3E7DA@35A??7D5;3>43E;E7J5>G6;@9F:7E3>7A8F7EF7@7D9K M('+,*- ,"('" '+ N:3EF:7?73@;@9E7F8ADF:;@)75F;A@6A8F:;E9D77?7@F M('+,*- ,"('" '+ * N:3EF:7?73@;@9E7F8ADF:;@)75F;A@6A8F:;E9D77?7@F M -%,"' *,15:3EF:7?73@;@9E7F8ADF:;@)75F;A@ 3A8F:;E9D77?7@F M . %()& '," !,+N:3EF:7?73@;@9E7F8ADF:;@)75F;A@ A8F:;E9D77?7@F M + & ',+N:3EF:7?73@;@9E7F8ADF:;@)75F;A@5A8F:;E9D77?7@F M '."*('& ',%,,*"-, +' ' ',". +N?73@E3@K7?;EE;A@E3;DCG3>;FKADAF:7D7@H;DA@?7@F3> 3FFD;4GF73EB75F5:3D35F7D;EF;55>3;?5D76;F47@78;FD76G5F;A@A88E7FAD3>>AI3@57:AIEA7H7D7@F;F>76AD 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 67E;9@3F766;D75F>KAD;@6;D75F>KD7EG>F;@98DA?3FFD;4GF34>7FAAD3EEA5;3F76I;F:F:75A@EG?BF;A@EFAD397 ;@<75F;A@E3>73@6 AD97@7D3F;A@A87@7D9K4K3EA>3DD7@7I34>77@7D9K835;>;FK3@6 ADF:DAG9:F:7EFAD397 3@6 AD;@<75F;A@A87>75FD;5;FKI:7F:7D7J;EF;@93EA8F:7 8875F;H73F7ADF:7D738F7D3@6I:7F:7D3E3D7EG>F A83@KBD7E7@FAD8GFGD7>A53>EF3F7AD8767D3>>3IEADD79G>3F;A@EAD>A53>EF3F7@3F;A@3>AD;@F7D@3F;A@3> HA>G@F3DKBDA9D3? M '."*('& ',%%"&+N:3EF:7?73@;@9E7F8ADF:;@)75F;A@ A8F:;E9D77?7@F M '."*('& ',%/N?73@E3@6;@5>G67EI;F:AGF>;?;F3F;A@3@KBD7E7@FAD8GFGD78767D3>EF3F7AD>A53> >3II:7F:7DG@67D5A??A@>3IEF3FGF7DG>7D79G>3F;A@ADAF:7DI;E7D7CG;D7?7@FEG@67D'7D?;FEADAF:7D 3GF:AD;L3F;A@E ;EEG76 I;F: D7EB75F F:7D7FA 3@6 AF:7D AD67DE 675D77E <G69?7@FE 6;D75F;H7 AD AF:7D D7CG;D7?7@FEA83@K AH7D@?7@F3>GF:AD;FKD7>3F;@9FAAD;?BAE;@9>;34;>;FKADEF3@63D6EA85A@6G5F 6;E5>AEGD7AD@AF;8;53F;A@I;F:D793D6FAF:7BDAF75F;A@A8:G?3@:73>F:F:77@H;DA@?7@F75A>A9;53> 5A@6;F;A@E 3L3D6AGE)G4EF3@57EAD3@K35F;H;FK;@HA>H;@9 3L3D6AGE)G4EF3@57E M . ',( -%,5:3EF:7?73@;@9E7F8ADF:;@)75F;A@ 3A8F:;E9D77?7@F M 0 * "+ (," 5:3EF:7?73@;@9E7F8ADF:;@)75F;A@3A8F:;E9D77?7@F M 0)"*,"(' , N :3E F:7 ?73@;@9 E7F 8ADF: A@ F:7 AH7D ):77F 3E EG5: 63F7 ?3K 47 7JF7@676 ;@ 355AD63@57I;F:F:79D77?7@F M 0, '+"(' 0 * "+ (," 5:3EF:7?73@;@9E7F8ADF:;@)75F;A@A8F:;E9D77?7@F M 0, '+"('),"('5:3EF:7?73@;@9E7F8ADF:;@)75F;A@A8F:;E9D77?7@F M 0, '+"(' *&5:3EF:7?73@;@9E7F8ADF:;@)75F;A@A8F:;E9D77?7@F M "'' "' *,1N?73@E3E3BB>;534>7;3@K'7DEA@AD;FE397@F8DA?I:A?#7EE77AD3@88;>;3F7A8 #7EE77>73E7EF:7)KEF7?AD;;3@K'7DEA@AD;FE397@FI:A:3E?367ADI;>>?3=73>A3@FAADAF:7DI;E7 BDAH;6753B;F3>FA#7EE77AD3@88;>;3F7A8#7EE77I;F:D7EB75FFAF:7)KEF7? #7EE77E:3>>BDAH;67ID;FF7@ @AF;57FA#7EEADA83@6F:75A@F35F;@8AD?3F;A@8AD3@K ;@3@5;@9'3DFKBD;ADFA3B3DFK47;@9677?763 ;@3@5;@9'3DFK:7D7G@67D M (* # -* . ',N?73@EI:7@GE76;@5A@@75F;A@I;F:F:7B7D8AD?3@57A83'3DFKPEA4>;93F;A@E G@67DF:;E9D77?7@F3@K7H7@FEAD5;D5G?EF3@57E47KA@6F:738875F76'3DFKPED73EA@34>75A@FDA>F:3F3D;E7 38F7DF:7 8875F;H73F7FAF:77JF7@F@AF53GE764KF:735FEADA?;EE;A@EA83@63D7AF:7DI;E7G@3HA;634>7 AD47KA@6F:7D73EA@34>75A@FDA>A83@65AG>6@AF:3H7477@BD7H7@F76ADAH7D5A?74KF:7D73EA@34>7 788ADFE3@66;>;97@57A8EG5:'3DFK3@6I:;5:?3F7D;3>>K3@636H7DE7>K38875FEEG5:'3DFKPEB7D8AD?3@57 A8 ;FE A4>;93F;A@E G@67D F:;E 9D77?7@F AD57 $3<7GD7 H7@F ;@5>G67E 4GF ;E @AF >;?;F76 FA F:7 8A>>AI;@9;I3DD;AF35FEA83BG4>;57@7?KADAF:7D5;H;>6;EFGD43@57;;35FEA8 A6;@5>G6;@94GF@AF >;?;F76FAB3@67?;5E7B;67?;5E6;E73E773DF:CG3=7EFAD@36AEFKB:AA@E>;9:F@;@94>;LL3D6E:GDD;53@7E 3@6 >3@6E>;67E A8 F:7 FKB7 I:;5: IAG>6 G@67D @AD?3> 5;D5G?EF3@57E 3@6 FKB;53> ;@EGD3@57 BA>;5;7E 5A@EF;FGF7 3@ 7H7@F A8 ;@EGD34>7 >AEE ;;;35FE A8 AD G@D73EA@34>K 7J57EE;H7 83;>GD7E FA 35F 4K 3@K AH7D@?7@F3>GF:AD;FK;@5>G6;@95:3@97E;@BB>;534>7#3I38F7DF:7 8875F;H73F7AF:7DF:3@35FEA8 AH7D@?7@F3>GF:AD;F;7E;@D7EBA@E7FA3'3DFKPE83;>GD7FA5A?B>KI;F:7J;EF;@9BB>;534>7#3IE3E D7CG;D76;@5A@@75F;A@I;F:B7D8AD?3@57G@67DF:;E9D77?7@F3@6;HEFD;=7EI3>=AGFE>A5=AGFEAD E;?;>3D;@6GEFD;3>AD>34AD35F;A@EAD6;EBGF7E@AF53GE764KEB75;8;5FA7?B>AK77EA8ADF:7D7EG>FA83@ G@83;D>34ADBD35F;57ADAF:7DG@>3I8G>35F;H;FK4KF:73EE7DF;@9'3DFK M (. *'& ',%))*(.%+N:3EF:7?73@;@9E7F8ADF:;@)75F;A@6A8F:;E9D77?7@F M (. *'& ',%-,!(*",1N?73@E3@K8767D3>EF3F7D79;A@3>5AG@FKFAI@5;FKAD?G@;5;B3>9AH7D@?7@F I:7F:7D6A?7EF;5AD8AD7;9@AD3@K67B3DF?7@F397@5K4GD73GADAF:7D36?;@;EFD3F;H7D79G>3FADKAD <G6;5;3>4A6KA83@KEG5:9AH7D@?7@F M 2* (-+-+,' +N?73@E3@6;@5>G67EI;F:AGF>;?;F3F;A@3@KEG4EF3@575:7?;53>?3F7D;3>AD I3EF7 ; F:7 BD7E7@57 A8 I:;5: 53GE7E 3 @G;E3@57 AD FD7EB3EEA8 3@K =;@6 G@67D 3@K 3BB>;534>7 'RFX6LJQ(QYHORSH,' )( % %$))&' ' @H;DA@?7@F3>#3I;;I:;5:;ED79G>3F764K3@K AH7D@?7@F3>GF:AD;FK;;;;E>;=7>KFA5D73F7>;34;>;FK G@67D 3@K @H;DA@?7@F3> #3I 4753GE7 A8 ;FE FAJ;5 8>3??34>7 5ADDAE;H7 D735F;H7 53D5;@A97@;5 ?GF397@;5;@875F;AGED36;A35F;H7ADAF:7D:3L3D6AGEBDAB7DFKAD4753GE7A8;FE78875FA@F:77@H;DA@?7@F @3FGD3>D7EAGD57EAD:G?3@:73>F:3@6E387FK;@5>G6;@94GF@AF>;?;F76FA8>3??34>7E3@67JB>AE;H7E 93EA>;@7B7FDA>7G?3@6B7FDA>7G?BDA6G5FE3E47EFAE5A@F3;@;@9?3F7D;3>EBA>K5:>AD;@3F764;B:7@K>E>736 3@6>73643E76B3;@FD36A@D36;A35F;H7?3F7D;3>E?;5DA4;3>?3FF7D4;A>A9;53>FAJ;@E?K5AFAJ;@E?A>6 AD?A>6EBAD7EAD3@K:3L3D6AGEADFAJ;5?3F7D;3>EG4EF3@57ADI3EF7I:;5:;E678;@764KF:AE7ADE;?;>3D F7D?EAD;ED79G>3F763EEG5:4K3@K AH7D@?7@F3>GF:AD;FKAD;HI:;5:;E67E;9@3F765>3EE;8;76AD D79G>3F763E47;@93:3L3D6AGEADFAJ;5EG4EF3@57?3F7D;3>BA>>GF3@FI3EF7AD3E;?;>3DEG5:67E;9@3F;A@ G@67D3@K8767D3>EF3F7AD>A53>>3ID79G>3F;A@ADAD6;@3@57;@5>G6;@9G@67D3@K @H;DA@?7@F3>#3I M '+(%,"('N:3EF:7?73@;@9E7F8ADF:;@)75F;A@ 9A8F:;E9D77?7@F M' N:3EF:7?73@;@9E7F8ADF:;@(75;F3> M + (&& ' & ',, N:3EF:7?73@;@9E7F8ADF:;@)75F;A@3A8F:;E9D77?7@F M + *&N:3EF:7?73@;@9E7F8ADF:A@F:7AH7D):77FA8F:;E9D77?7@F * +#$ #$ "$ $ $ #" $ M ++ *," +N?73@E;@6;H;6G3>>KAD5A>>75F;H7>K#7EE77;FE88;>;3F7E3@63@KA8F:7;D3GF:AD;L76 D7BD7E7@F3F;H7E397@FE7?B>AK77E?3@397DE5A@FD35FADE3D5:;F75FE3@67@9;@77DE3@6735:A8F:7;D D7EB75F;H7 A88;57DE 6;D75FADE B3DF@7DE ?7?47DE ?3@397DE 397@FE 7?B>AK77E D7BD7E7@F3F;H7E 3@6 ;@H;F77E M ++ 0 +N:3EF:7?73@;@9E7F8ADF:;@)75F;A@ A8F:;E9D77?7@F M ++(**," +N?73@E;@6;H;6G3>>KAD5A>>75F;H7>K#7EEAD;FE88;>;3F7E3@63@KA8F:7;D3GF:AD;L76 D7BD7E7@F3F;H7E397@FE7?B>AK77E?3@397DE3@6735:A8F:7;DD7EB75F;H7A88;57DE6;D75FADEB3DF@7DE ?7?47DE?3@397DE397@FE7?B>AK77E3@6D7BD7E7@F3F;H7E M( % % ,*" ,"%",1N ?73@E F:7 >A53> 7>75FD;5 6;EFD;4GF;A@ AI@7D 3@6 AB7D3FAD BDAH;6;@9 7>75FD;5 6;EFD;4GF;A@E7DH;57EFA#7EE773@63>EABDAH;6;@97>75FD;56;EFD;4GF;A@3@6;@F7D5A@@75F;A@E7DH;57EFA #7EE778AD#7EE77PE)KEF7? M(' -%,"' *,15:3EF:7?73@;@9E7F8ADF:;@)75F;A@ 3A8F:;E9D77?7@F MN:3EF:7?73@;@9E7F8ADF:;@)75F;A@ 8A8F:;E9D77?7@F M) *,"(' *&N:3EF:7?73@;@9E7F8ADF:;@)75F;A@4A8F:;E9D77?7@F M),"('N:3EF:7?73@;@9E7F8ADF:;@)75F;A@3A8F:;E9D77?7@F M),"(' *&N:3EF:7?73@;@9E7F8ADF:;@)75F;A@4A8F:;E9D77?7@F M*,15(*4*," +5:3EF:7?73@;@9E7F8ADF:A@B397 A8F:;E9D77?7@F M *&",+N?73@E3>>3BB>;53F;A@E3BBDAH3>E3GF:AD;L3F;A@E5A@E7@FE8;>;@9E>;57@E7EAD67DEB7D?;FEAD E;?;>3DD7CG;D7?7@FE;?BAE764K3@K AH7D@?7@F3>GF:AD;FKI:;5:3D7D7CG;D76;@AD67DFA67H7>AB 5A@EFDG5FAB7D3F7?3;@F3;@;?BDAH7D78GD4;E:3@6D7F;D7F:7)KEF7?ADFAE5:76G>73@667>;H7DF:77>75FD;5 7@7D9KBDA6G5764KF:7)KEF7?FAF:7#A53> >75FD;5+F;>;FK;@5>G6;@93@3GF:AD;L3F;A@FA5A@EFDG5FAD3 5A@6;F;A@3>GE7B7D?;F M *+('N?73@E3@K;@6;H;6G3>5ADBAD3F;A@B3DF@7DE:;B>;?;F76>;34;>;FK5A?B3@K<A;@FH7@FGD77EF3F7 FDGEFG@;@5ADBAD3F763EEA5;3F;A@3@KAF:7DB7DEA@AD7@F;FK3@63@K8767D3>EF3F75AG@FKAD?G@;5;B3> 9AH7D@?7@FAD3@K4GD73G67B3DF?7@FAD397@5KF:7D7A83@63@K8;6G5;3DK35F;@9;@EG5:53B35;FKA@47:3>8 A83@KA8F:78AD79A;@9 M *+('%*() *,10 +N:3EF:7?73@;@9E7F8ADF:;@)75F;A@ A8F:79D77?7@F 'RFX6LJQ(QYHORSH,' )( % %$))&' ' M* &"+ +N:3EF:7?73@;@9E7F8ADF:;@(75;F3>A8F:;E9D77?7@F M*() *,1N:3EF:7?73@;@9E7F8ADF:;@(75;F3>A8F:;E9D77?7@F M-%" " "%N:3EF:7?73@;@9E7F8ADF:;@)75F;A@ A8F:;E9D77?7@F M &(.%, *&N:3EF:7?73@;@9E7F8ADF:;@)75F;A@5A8F:;E9D77?7@F M ',N:3EF:7?73@;@9E7F8ADF:A@F:7AH7D):77FA8F:;E9D77?7@F * +#$ #$ "$ $ $ #" $ * +#$ #$ "$ $ $ #" $ M -*",1 ', * +,N:3EF:7?73@;@9E7F8ADF:;@)75F;A@ @A8F:;E9D77?7@F M1+, &+N?73@EF:7EA>3DB:AFAHA>F3;53@6 AD7@7D9KEFAD397EKEF7?ADEKEF7?E;@EF3>>763@6AB7D3F;@9 3FF:7'D7?;E7EFA97F:7DI;F:3>>7>75FD;53>BDA6G5F;A@FD3@E?;EE;A@EFAD3973@66;EFD;4GF;A@835;>;F;7E3@6 D7>3F767CG;B?7@F:3D6I3D73@6?3F7D;3>E;@5>G6;@9I;F:AGF>;?;F3F;A@B3@7>EAH7D:7363@6G@67D9DAG@6 FD3@E?;EE;A@6;EFD;4GF;A@AD5A>>75FAD>;@7E5;D5G;F4D73=7DE?7F7DE5A@6G;F8AAF;@9E534>;@9I;D7E AH7D:7363@6G@67D9DAG@65A@FDA>5A??G@;53F;A@E3@6D36;AD7>3KEKEF7?E7@7D9KEFAD397835;>;F;7E ;@5>G6;@9 43FF7D;7E ;@F7D5A@@75F;A@ 835;>;F;7E 3@6 AD EI;F5:;@9 835;>;F;7E FD3@E8AD?7DE 3@6 5GDD7@F ;@H7DF7DE5A@FDA>4AJ7E3@65A?BGF7D?A@;FAD;@97CG;B?7@FEKEF7?EEFDG5FGD7E43FF7D;7E873FGD7E3@6 ;?BDAH7?7@FE@757EE3DKFABDA6G57FD3@E?;F3@6EFAD77>75FD;57@7D9K3FEG5:835;>;FK7J5>G6;@9BAI7DFA F:7'DAB7DFK M1+, &(++N:3EF:7?73@;@9E7F8ADF:;@)75F;A@ 4A8F:;E9D77?7@F M1+, & &(.%N:3EF:7?73@;@9E7F8ADF:;@)75F;A@5A8F:;E9D77?7@F M0 +' ++ ++& ',+N:3EF:7?73@;@9E7F8ADF:;@)75F;A@ A8F:;E9D77?7@F M +,+N:3EF:7?73@;@9E7F8ADF:;@)75F;A@ A8F:;E9D77?7@F * +#$ #$ "$ $ $ #" $ 'RFX6LJQ(QYHORSH,' )( % %$))&' ' ! 'RFX6LJQ(QYHORSH,' )( % %$))&' ' ! # **&99&(-*)$ 'RFX6LJQ(QYHORSH,' )( % %$))&' ' *(47).3,*6:*89*)'>&3) &+9*77*(47).3,7*9:7394 222222222222222222## 5 AADD79A)A>3D)KEF7?E @5 D3@=>;@)FD77F)G;F7 &3=>3@6 FF@#793>7B3DF?7@F * )$ $&(%+$& &'* &%%# ) F:7M &(*' -&N;E?3673EA8 2222222222 24K3@647FI77@02222222222222222222221032222222222222222:3H;@9;FE BD;@5;B3>B>357A84GE;@7EE>A53F763F103@;@6;H;6G3>I;F:3@366D7EEA8122222222222222222222222 2222222222222 >>;@A;EM ++(*N3@6%%%%%%%%%%%%%%%%%%37>3I3D7>;?;F76>;34;>;FK 5A?B3@KI;F:;FEBD;@5;B3>B>357A84GE;@7EE>A53F763F D3@=>;@)FD77F)G;F7 &3=>3@6 3>;8AD@;3 M ++ N #7EEAD3@6#7EE773D7B3DF;7EFAF:3F57DF3;@&BF;A@3@6#73E79D77?7@FF:7M + N 63F763EA8 F:7M ,". , N5AH7D;@93BADF;A@A8F:3F57DF3;@ B3D57>A8>3@63@6F:7;?BDAH7?7@FEF:7D7A@5A??A@>K=@AI@3E22222222222222 >>;@A;E3@6;67@F;8;76;@F:7677663F76222222222223@6D75AD676;@F:7 222222222222222AG@FK(75AD67DPE&88;573FAA=22222'3972222F:7 M*() *,1N +@67DF:7#73E7#7EE77:3E3@ABF;A@FA>73E73BADF;A@1A8F:7'DAB7DFK3@635CG;D7 73E7?7@FEAH7D3BADF;A@A8F:7'DAB7DFK3E67E5D;476;@=-.'.9 3@@7J76:7D7FAF:7 M* &"+ +NI:;5:ABF;A@5A??7@57EA@F:7 8875F;H73F73@6>3EFE8AD8;H7:G@6D76 8ADFK 63KEF:7D738F7D *:7ABF;A@F7D??3K477JF7@6768ADFIA 366;F;A@F7D?E A8F:D77:G@6D76E;JFK8;H763KE735: *:75A??7@57?7@F63F7A8#7EEADPE>73E7A8F:7'D7?;E7EE:3>>47F:763F7A8#7EEADPE 7J7D5;E7A8F:7ABF;A@ 8F:7ABF;A@;E7J7D5;E76F:7;@;F;3>F7D?A8F:7>73E73@6F:773E7?7@FEI;>>478AD FI7@FK K73DE3@6#7EE77E:3>>:3H7F:7ABF;A@FA7JF7@6F:7>73E78ADGBFA8AGD 366;F;A@3>8;H7K73DF7D?EEG4<75FFA73D>;7DF7D?;@3F;A@AD7JF7@E;A@BGDEG3@FFAF:7 F7D?EA8F:7#73E7AD3BB>;534>7>3I *:7)KEF7?3E678;@76;@F:7#73E7;@EF3>>763@6AB7D3F764K#7EE773FF:7'D7?;E7E E:3>>@AF47677?7638;JFGD7 *:7)KEF7?;E#7EE77PEB7DEA@3>BDAB7DFK3@6#7EEAD:3E @AD;9:FF;F>7AD;@F7D7EF;@F:7)KEF7? GDF:7D#7EEAD:3EI3;H763>>D;9:FA8>7HK8AD D7@F3>>5>3;?E3@667?3@6E393;@EFF:7)KEF7?3@63>>D;9:FE;F?3K:3H7FAB>3573>;7@ A@F:7)KEF7? >>A8F:7F7D?E5AH7@3@FE3@65A@6;F;A@EA8F:7#73E73D7;@5ADBAD3F76:7D7;@3@6 ?3673B3DF:7D7A8 *:7BGDBAE7A8F:;E$7?AD3@6G?;EFA9;H7@AF;57A8F:77J;EF7@57 A8F:7F7@3@5K3@673E7?7@FE5D73F764KF:7#73E73@6E:3>>@AF475A@EFDG76FAH3DKAD AF:7DI;E738875FF:7D;9:FEADA4>;93F;A@EA8F:7B3DF;7EG@67DF:7#73E73E;F?3K47 'RFX6LJQ(QYHORSH,' )( % %$))&' ' 3?7@676 >>53B;F3>;L76F7D?E@AF678;@76:7D7;@:3H7F:7?73@;@93FFD;4GF76FAF:7? ;@F:7#73E7 'RFX6LJQ(QYHORSH,' )( % %$))&' ' %- *% ))- ( & F:7B3DF;7E:3H76G>K7J75GF76F:;E$7?AD3@6G?3EA8F:763F78;DEF34AH7 ID;FF7@ 222222222222222222222222222 0%3?7A8*DGEF771*DGEF77A8F:7 0%3?7A8*DGEF163F76063F7A8*DGEF1 2222222222222222222222 &*1&<&7*1.2.9*)1.&'.1.9>(425&3> K ;FEEA>7?7?47D3@6?3@397D K22222222222222222222222222222 %3?7222222222222222222222222222 *;F>72222222222222222222222222222 'RFX6LJQ(QYHORSH,' )( % %$))&' ' ! 94 *247&3):24+59.43&3)*&8* 'RFX6LJQ(QYHORSH,' )( % %$))&' ' ! 03F71 *A-:A? F$3KA@57D@ ADD79A)A>3D)KEF7?E @5 3@6;FE7?B>AK77E3@6388;>;3F7E3D7:7D74K3GF:AD;L76FA35F3EAGD397@F 8ADEG4?;EE;A@A83BB>;53F;A@E3@6D7>3F76B>3@E3@66A5G?7@FE3@6FA3BB73D478AD74A3D6E3@6 AF:7DA88;5;3>EI;F:D7EB75FFAA4F3;@;@93BBDAH3>E8ADEA>3D;@EF3>>3F;A@E3@6 AD7@7D9KEFAD397 EKEF7?EFA475A@EFDG5F76A@?KBDAB7DFK>A53F763F0BDAB7DFK366D7EE1 );@57D7>K 0&I@7DPE%3?71 'RFX6LJQ(QYHORSH,' )( % %$))&' ' ! * ) ()*$ %$ %**&&'* &%%# ) ( $ %*M& ' & ',N;E ?3673@67@F7D76;@FA3EA822222222222222222 2F:7M ,". , N47FI77@ %%%%%%%%%%%%%%%%%%%%%%%M ++(*N3@6%%%%%%%%%%%%%%%%%%37>3I3D7>;?;F76>;34;>;FK 5A?B3@KF:7M ++ N #7EEAD3@6#7EE777@F7D76;@FAF:3F57DF3;@&BF;A@3@6#73E79D77?7@F63F76 222222222222222 2 I;F: D7EB75F FA F:7 BDAB7DFK 5A??A@>K =@AI@ 3E 222222222222222222 5A>>75F;H7>KF:7M + N F:7>793>67E5D;BF;A@E8ADF:7'D7?;E7EE:AI@A@ J:;4;FI7D743E76A@BD7>;?;@3DK E;F76;E5AH7DK;@8AD?3F;A@3@6I7D75A@F7?B>3F76FA47D7B>3576I;F:35FG3>?7F7E3@64AG@6EGBA@ 5A?B>7F;A@A8)KEF7?67E;9@3@6E;F7EGDH7K #7EE77:3E5A?B>7F76;FE)KEF7?67E;9@3@6E;F7EGDH7K3@6F:7B3DF;7E@AIE77=FA D7B>357F:7>793>67E5D;BF;A@E3FF35:76FA J:;4;FI;F:F:7>793>67E5D;BF;A@E8ADF:75GDD7@F67E;9@ F:7B3DF;7E67E;D7FA3?7@6F:7#73E7A@F:7F7D?E3@65A@6;F;A@E5A@F3;@76:7D7;@ 8AD9AA63@6H3>G34>75A@E;67D3F;A@F:7D757;BF3@6367CG35KA8I:;5: 3D7:7D74K35=@AI>76976F:7B3DF;7E:7D74K39D773E8A>>AIE " " $ #" "! "$" # #$ "$$ $ ! $ )$" # $ $"' # " # &$ # & $ #%$" # $ # "" #" $ $## %$## ($ # $ 7*2.8*8=-.'.9 J:;4;FA8F:7#73E7;E:7D74K67>7F76;@;FE7@F;D7FK3@6D7B>3576 I;F: (-*):1*3FF35:76:7D7FA &9.+.(&9.43 :1147(*&3)++*(9 J57BF3E3?7@6764KF:;E?7@6?7@FF:7#73E7 ;E:7D74KD3F;8;765A@8;D?763@63BBDAH76;@3>>D7EB75FE 74;.8.438 .3).3, >>D;9:FE3@6>;34;>;F;7E9;H7@FAAD;?BAE76GBA@7;F:7DA8F:7B3DF;7E FAF:;E?7@6?7@FE:3>>7JF7@6FA3@63D74;@6;@9GBA@F:7B3DF;7E:7D7FA3@6F:7;DD7EB75F;H7EG557EEADE 3@63EE;9@E 39.7* ,7**2*39 *:;E?7@6?7@F3FA97F:7DI;F:F:7#73E75A@F3;@EF:77@F;D7 39D77?7@F47FI77@F:7B3DF;7EI;F:D7EB75FFAF:7EG4<75F?3FF7D:7D7A83@6EGB7DE767E3>>BD;AD39D77?7@FE 3@6G@67DEF3@6;@9EI:7F:7DAD3>ADID;FF7@47FI77@F:7B3DF;7E4?3K@AF47?A6;8;76AD3?7@676 7J57BF4KID;FF7@39D77?7@FE;9@764KF:7B3DF;7E5I;>>479AH7D@764KF:7>3IEA8F:7)F3F7A8 >>;@A;E I;F:AGFD793D6FABD;@5;B>7EA85A@8>;5FEA8>3IE3@66?3K477J75GF764K835E;?;>7E;9@3FGD73@6;@A@7 AD?AD75AG@F7DB3DFE735:A8I:;5:I;>>47677?763@AD;9;@3>3@63>>A8I:;5:I:7@F3=7@FA97F:7DI;>> 5A@EF;FGF7A@73@6F:7E3?7;@EFDG?7@F #" ',-* +(',! (%%(/"' $ 'RFX6LJQ(QYHORSH,' )( % %$))&' ' F:7B3DF;7E:7D7FA:3H77J75GF76F:;E?7@6?7@F3EA8F:763F78;DEF 34AH7ID;FF7@ K222222222222222222222222222222 %3?72222222222222222222222222222 *;F>722222222222222222222222222222 22222222222222222222222222222 37>3I3D7>;?;F76>;34;>;FK5A?B3@K K 41&7*;*1452*39 ;FEEA>7?7?47D3@6?3@397D K222222222222222222222222222222 %3?72222222222222222222222222222 *;F>722222222222222222222222222222 'RFX6LJQ(QYHORSH,' )( % %$))&' ' ! 'RFX6LJQ(QYHORSH,' )( % %$))&' ' NATURAL RESOURCE INFORMATION (NRI) REPORT: #2217 Nov. 2022 Petitioner: 312 Solar Development, LLC Contact: Dean Smith (New Leaf Energy) Prepared By: 7775A Route 47 Yorkville, Illinois 60560 Phone: (630) 553-5821 x3 www.kendallswcd.org NRI 2217 November 2022 Natural Resource Information Report Number 2217 Date District Board Reviews Application November 2022 Applicant’s Name 312 Solar Development, LLC Size of Parcel (+/-) 19 acres Current Zoning & Use A-1 Agricultural; Agricultural field Proposed Zoning & Use A-1 Agricultural Special Use; Solar Garden Parcel Index Number(s) 02-18-400-002, 02-17-300-002 Contact Person Dean Smith (New Leaf Energy) Copies of this report or notification of the proposed land-use change was provided to: Yes No The Applicant X X The Applicant’s Legal Representation The Local/Township Planning Commission X The Village/City/County Planning and Zoning Department or Appropriate Agency X The Kendall County Soil and Water Conservation District Files X Report Prepared By: Alyse Olson Position: Resource Conservationist KENDALL COUNTY SOIL AND WATER CONSERVATION DISTRICT NATURAL RESOURCE INFORMATION (NRI) REPORT NRI 2217 November 2022 PURPOSE AND INTENT The purpose of this report is to provide officials of the local governing body and other decision-makers with natural resource information. This information may be useful when undertaking land use decisions concerning variations, amendments or relief of local zoning ordinances, proposed subdivision of vacant or agricultural lands and the subsequent development of these lands. This report is a requirement under Section 22.02a of the Illinois Soil and Water Conservation Districts Act. The intent of this report is to present the most current natural resource information available in a readily understandable manner. It contains a description of the present site conditions, the present resources, and the potential impacts that the proposed change may have on the site and its resources. The natural resource information was gathered from standardized data, on-site investigations and information furnished by the petitioner. This report must be read in its entirety so that the relationship between the natural resource factors and the proposed land use change can be fully understood. Due to the limitations of scale encountered with the various resource maps, the property boundaries depicted in the various exhibits in this report provide a generalized representation of the property location and may not precisely reflect the legal description of the PIQ (Parcel in Question). This report, when used properly, will provide the basis for proper land use change decisions and development while protecting the natural resource base of the county. It should not be used in place of detailed environmental and/or engineering studies that are warranted under most circumstances, but in conjunction with those studies. The conclusions of this report in no way indicate that a certain land use is not possible, but it should alert the reader to possible problems that may occur if the capabilities of the land are ignored. Any questions on the technical data supplied in this report or if anyone feels that they would like to see more additional specific information to make the report more effective, please contact: Kendall County Soil and Water Conservation District 7775A Route 47, Yorkville, IL 60560 Phone: (630) 553-5821 ext. 3 E-mail: Alyse.Olson@il.nacdnet.net NRI 2217 November 2022 TABLE OF CONTENTS EXECUTIVE SUMMARY .................................................................................................................................. 1 PARCEL LOCATION ........................................................................................................................................ 7 ARCHAEOLOGIC/CULTURAL RESOURCES INFORMATION ............................................................................. 9 ECOLOGICALLY SENSITIVE AREAS ............................................................................................................... 10 SOILS INFORMATION .................................................................................................................................. 12 SOILS INTERPRETATIONS EXPLANATION..................................................................................................... 14 BUILDING LIMITATIONS .............................................................................................................................. 15 SOIL WATER FEATURES ............................................................................................................................... 20 SOIL EROSION AND SEDIMENT CONTROL ................................................................................................... 23 PRIME FARMLAND SOILS ............................................................................................................................ 24 LAND EVALUATION AND SITE ASSESSMENT (LESA) .................................................................................... 25 LAND USE PLANS ......................................................................................................................................... 27 DRAINAGE, RUNOFF, AND FLOOD INFORMATION ..................................................................................... 2 7 WATERSHED PLANS .................................................................................................................................... 31 WETLAND INFORMATION ........................................................................................................................... 32 HYDRIC SOILS .............................................................................................................................................. 34 WETLAND AND FLOODPLAIN REGULATIONS .............................................................................................. 36 GLOSSARY.................................................................................................................................................... 37 REFERENCES ................................................................................................................................................ 40 LIST OF FIGURES FIGURE 1: Soil Map ………………………………..……………………..……………………………………………………..………………… 2 FIGURE 2: Soil Limitations …………..……………………………………………………….…………………………………………………. 4 FIGURE 3: 2021 Plat Map ………………..……………………………………………………….………...………………………………….. 7 FIGURE 4: 2019 Aerial Map with NRI Site Boundary ……………………………….…………….………….……………..…….. 8 FIGURE 5: Soil Map ………………………………………………………………………………….…………………………………………… 13 FIGURE 6A-6C: Maps of Building Limitations ……………………………………………..……………………………..…….. 17-19 NRI 2217 November 2022 FIGURE 7: Map of Prime Farmland Soils …………………………………………………………………..…………………….…….. 24 FIGURE 8: FEMA Floodplain Map ……………………..………………….……………….……………….……………………………… 29 FIGURE 9: USGS Topographic Map …………………………………………………………………..………………….……………….. 30 FIGURE 10: Wetland Map – USFWS National Wetland Inventory …………………………………..…….……….………. 33 FIGURE 11: Hydric Soils Map …………………………………………………………………………………….……….…….…………… 35 LIST OF TABLES TABLE 1: Soils Information ……………………………………………………………….…………………………………………………….. 2 TABLE 2: Soil Limitations ………………………………..………………………………………………….……………………….………….. 4 TABLE 3: Soil Map Unit Descriptions …………………………………………………………….…………………………..………….. 13 TABLE 4: Building Limitations ……………………………………………………………………………………………………………….. 16 TABLE 5: Water Features ……………………………………………………………………………………………………………………… 21 TABLE 6: Soil Erosion Potential ……………………………………………………………………………………………….……………. 23 TABLE 7: Prime Farmland Soils …………………………………………………………………………………………………..…………. 24 TABLE 8: Land Evaluation Computation …………………………………………………………..…………………………..………. 25 TABLE 9: Hydric Soils ………………………..……………………………………………………..…………………………….…..………… 34 NRI 2217 November 2022 1 EXECUTIVE SUMMARY Natural Resource Information Report Number #2217 Petitioner 312 Solar Development, LLC Contact Person Dean Smith (New Leaf Energy) County or Municipality the Petition is Filed With United City of Yorkville Location of Parcel SW ¼ of Section 17, SE ¼ of Section 18, Township 37 North, Range 7 East (Bristol Township) of the 3rd Principal Meridian Project or Subdivision Name Beecher Road Solar Garden Existing Zoning & Land Use A-1 Agricultural; Agricultural field Proposed Zoning & Land Use A-1 Agricultural Special Use; Solar Garden Proposed Water Source N/A Proposed Type of Sewage Disposal System N/A Proposed Type of Storm Water Management N/A Size of Site (+/-) 19 acres Land Evaluation Site Assessment Score Land Evaluation: 85; Site Assessment: N/A NRI 2217 November 2022 2 NATURAL RESOURCE CONSIDERATIONS Figure 1: Soil Map SOIL INFORMATION Based on information from the United States Department of Agriculture-Natural Resources Conservation Service (USDA-NRCS) 2008 Kendall County Soil Survey, this parcel is shown to contain the following soil types (please note this does not replace the need for or results of onsite soil testing; if completed, please refer to onsite soil test results for planning/engineering purposes): Table 1: Soils Information Map Unit Soil Name Drainage Class Hydrologic Group Hydric Designation Farmland Designation 134C2 Camden silt loam, 5-10% slopes, eroded Well Drained B Non-Hydric, Hydric Inclusions Likely Farmland of Statewide Importance 149A Brenton silt loam, 0-2% slopes Somewhat Poorly Drained B/D Non-Hydric, Hydric Inclusions Likely Prime Farmland 330A Peotone silty clay loam, 0-2% slopes Very Poorly Drained C/D Hydric Prime Farmland if Drained 668B Somonauk silt loam, 2-5% slopes Moderately Well Drained C Non-Hydric Prime Farmland NRI 2217 November 2022 3 Hydrologic Soil Groups – Soils have been classified into four (A, B, C, D) hydrologic groups based on runoff characteristics due to rainfall. If a soil is assigned to a dual hydrologic group (A/D, B/D or C/D), the first letter is for drained areas and the second letter is for undrained areas. xHydrologic group A: Soils have a high infiltration rate (low runoff potential) when thoroughly wet. These consist mainly of deep, well drained to excessively drained sands or gravelly sands. These soils have a high rate of water transmission. xHydrologic group B: Soils have a moderate infiltration rate when thoroughly wet, consist chiefly of moderately deep to deep, moderately well drained to well drained soils that have a moderately fine to moderately coarse texture. These soils have a moderate rate of water transmission. xHydrologic group C: Soils having a slow infiltration rate when thoroughly wet. These consist chiefly of soils having a layer that impedes the downward movement of water or soils of moderately fine texture or fine texture. These soils have a slow rate of water transmission. xHydrologic group D: Soils having a very slow infiltration rate (high runoff potential) when thoroughly wet. These consist chiefly of clays that have a high shrink-swell potential, soils that have a high water table, have a claypan or clay layer at or near the surface, and soils that are shallow over nearly impervious material. These soils have a very slow rate of water transmission. Hydric Soils – A hydric soil is one that formed under conditions of saturation, flooding, or ponding long enough during the growing season to develop anaerobic conditions in the upper part of the soil profile that supports the growth or regeneration of hydrophytic vegetation. Soils with hydric inclusions have map units dominantly made up of non-hydric soils that may have inclusions of hydric soils in the lower positions on the landscape. Of the soils found onsite, one is classified as hydric soil (330A Peotone silty clay loam), one is classified as non-hydric soil (668B Somonauk silt loam), and two are classified as non-hydric soil with hydric inclusions likely (134C2 Camden silt loam and 149A Brenton silt loam). Prime Farmland – Prime farmland is land that has the best combination of physical and chemical characteristics for agricultural production. Prime farmland soils are an important resource to Kendall County and some of the most productive soils in the United States occur locally. Of the soils found onsite, two are designated as prime farmland (149A Brenton silt loam and 668B Somonauk silt loam), one is designated as prime farmland if drained (330A Peotone silty clay loam), and one is designated as farmland of statewide importance (134C2 Camden silt loam). All are considered designations of prime farmland. Soil Limitations – The USDA-NRCS Web Soil Survey rates the limitations of soils for dwellings, small commercial buildings, solar arrays, shallow excavations, lawns/landscaping, local roads and streets, etc. Soils have different properties which influence the development of building sites. The USDA-NRCS classifies soils as Not Limited, Somewhat Limited, and Very Limited. Soils that are Not Limited indicates that the soil has properties that are favorable for the specified use. They will perform well and will have low maintenance. Soils that are Somewhat Limited are moderately favorable, and their limitations can be overcome through special planning, design, or installation. Soils that are Very Limited have features that are unfavorable for the specified use, and their limitations cannot easily be overcome. NRI 2217 November 2022 4 Table 2:Soil Limitations Soil Type Solar Arrays, Soil- Based Anchor Systems Solar Arrays, Ballast Anchor Systems Shallow Excavations Lawns/ Landscaping Local Roads & Streets 134C2 Very Limited Very Limited Somewhat Limited Somewhat Limited Very Limited 149A Very Limited Very Limited Very Limited Somewhat Limited Very Limited 330A Very Limited Very Limited Very Limited Very Limited Very Limited 668B Very Limited Very Limited Somewhat Limited Somewhat Limited Very Limited Figure 2: Soil Limitations KENDALL COUNTY LAND EVALUATION AND SITE ASSESSMENT (LESA) Decision-makers in Kendall County use the Land Evaluation and Site Assessment (LESA) system to determine the suitability of a land use change and/or a zoning request as it relates to agricultural land. The LESA system was developed by the United States Department of Agriculture-Natural Resources Conservation Service (USDA-NRCS) and takes into consideration local conditions such as physical characteristics of the land, compatibility of surrounding land-uses, and urban growth factors. The LESA system is a two-step procedure that includes: x Land Evaluation (LE): The soils of a given area are rated and placed in groups ranging from the best to worst suited for a stated agriculture use, cropland, or forestland. The best group is assigned a value of 100 and all other groups are assigned lower values. The Land Evaluation is based on data from the Kendall County Soil Survey. The Kendall County Soil and Water Conservation District is responsible for this portion of the LESA system. The Land Evaluation score for this site is 85, indicating that the soils are well suited for agricultural uses. x Site Assessment (SA): The site is numerically evaluated according to important factors that contribute to the quality of the site. Each factor selected is assigned values in accordance with the local needs and objectives. The Site Assessment value is based on a 200-point scale and accounts for 2/3 of the total score. The Kendall County LESA Committee is responsible for this portion of the LESA system. Please Note: A land evaluation (LE) score will be compiled for every project parcel. However, when a parcel is located within municipal planning boundaries, a site assessment (SA) score is not compiled as the scoring factors are not applicable. As a result, only the LE score is available, and 0 20 40 60 80 100 Solar Arrays, Soil- Based Anchor Systems Solar Arrays, Ballast Anchor Systems Shallow Excavations Lawns/Landscaping Local Roads & Streets % OF SOIL TYPE OF IMPROVEMENT SOIL LIMITATIONS Not Limited Somewhat Limited Very Limited NRI 2217 November 2022 5 a full LESA score is unavailable for the parcel. The Site Assessment score for this site is not applicable. WETLANDS The U.S. Fish & Wildlife Service’s National Wetlands Inventory map does not indicate the presence of a wetland(s)/waters on the proposed project site. To determine if a wetland is present, a wetland delineation specialist, who is recognized by the U.S. Army Corps of Engineers, should determine the exact boundaries and value of the wetlands. Please note that a Wetland Delineation Report dated July 22, 2022 was prepared by ENCAP, Inc. The results of their on-site investigation indicated the presence of two farmed wetlands within the project area. One off-site wetland (Rob Roy Creek) was also identified. FLOODPLAIN The Federal Emergency Management Agency’s (FEMA) Flood Insurance Rate Map (FIRM) for Kendall County, Community Panel No. 17093C0040G (effective date February 4, 2009) was reviewed to determine the presence of floodplain and floodway areas within the project site. According to the map, the site is not located within the floodplain or floodway. SEDIMENT AND EROSION CONTROL Development on this site should include an erosion and sediment control plan in accordance with local, state, and federal regulations. Soil erosion on construction sites is a resource concern because suspended sediment from areas undergoing development is a primary nonpoint source of water pollution. Please consult the Illinois Urban Manual (https://illinoisurbanmanual.org/) for appropriate best management practices. STORMWATER POLLUTION A National Pollutant Discharge Elimination System (NPDES) permit (Permit No. ILR10) from the Illinois Environmental Protection Agency (IEPA) is required for stormwater discharges from construction sites that will disturb 1 or more acres of land. Conditions of the NPDES ILR10 permit require the development and implementation of a Stormwater Pollution Prevention Plan (SWPPP) to reduce stormwater pollutants on the construction site before they can cause environmental issues. NRI 2217 November 2022 7 PARCEL LOCATION Figure 3: 2021 Plat Map Location Map for Natural Resources Information Report #2217 SW ¼ of Section 17, SE ¼ of Section 18, Township 37 North, Range 7 East (Bristol Township) on approximately 19 acres. This parcel is located on the east side of Beecher Road, south of Corneils Road, west of Rob Roy Creek, and north of the Burlington Northern Santa Fe (BNSF) Railroad in Yorkville, IL. NRI 2217 November 2022 8 Figure 4: 2021 Aerial Map with NRI Project Boundary NRI 2217 November 2022 9 ARCHAEOLOGIC/CULTURAL RESOURCES INFORMATION Simply stated, cultural resources are all the past activities and accomplishments of people. They include the following: buildings; objects made or used by people; locations; and less tangible resources, such as stories, dance forms, and holiday traditions. The Soil and Water Conservation District most often encounters cultural resources as historical properties. These may be prehistoric or historical sites, buildings, structures, features, or objects. The most common type of historical property that the Soil and Water Conservation District may encounter is non-structural archaeological sites. These sites often extend below the soil surface and must be protected against disruption by development or other earth moving activity if possible. Cultural resources are non- renewable because there is no way to “grow” a site to replace a disrupted site. Landowners with historical properties on their land have ownership of that historical property. However, the State of Illinois owns all the following: human remains, grave markers, burial mounds, and artifacts associated with graves and human remains. Non-grave artifacts from archaeological sites and historical buildings are the property of the landowner. The landowner may choose to disturb a historical property but may not receive federal or state assistance to do so. If an earth moving activity disturbs human remains, the landowner must contact the county coroner within 48 hours. The Illinois Historic Preservation Agency has not been notified of the proposed land use change by the Kendall County SWCD. The applicant may need to contact the IHPA according to current Illinois law. NRI 2217 November 2022 10 ECOLOGICALLY SENSITIVE AREAS WHAT IS BIOLOGICAL DIVERSITY AND WHY SHOULD IT BE CONSERVED?1 Biological diversity, or biodiversity, is the range of life on our planet. A more thorough definition is presented by botanist Peter H. Raven: “At the simplest level, biodiversity is the sum total of all the plants, animals, fungi and microorganisms in the world, or in a particular area; all of their individual variation; and all of the interactions between them. It is the set of living organisms that make up the fabric of the planet Earth and allow it to function as it does, by capturing energy from the sun and using it to drive all of life’s processes; by forming communities of organisms that have, through the several billion years of life’s history on Earth, altered the nature of the atmosphere, the soil and the water of our Planet; and by making possible the sustainability of our planet through their life activities now” (Raven 1994). It is not known how many species occur on our planet. Presently, about 1.4 million species have been named. It has been estimated that there are perhaps 9 million more that have not been identified. What is known is that they are vanishing at an unprecedented rate. Reliable estimates show extinction occurring at a rate several orders of magnitude above “background” in some ecological systems (Wilson 1992, Hoose 1981). The reasons for protecting biological diversity are complex, but they fall into four major categories. First, loss of diversity generally weakens entire natural systems. Healthy ecosystems tend to have many natural checks and balances. Every species plays a role in maintaining this system. When simplified by the loss of diversity, the system becomes more susceptible to natural and artificial perturbations. The chances of a system-wide collapse increase. In parts of the midwestern United States, for example, it was only the remnant areas of natural prairies that kept soil intact during the dust bowl years of the 1930s (Roush 1982). Simplified ecosystems are almost always expensive to maintain. For example, when synthetic chemicals are relied upon to control pests, the target species are not the only ones affected. Their predators are almost always killed or driven away, exasperating the pest problem. In the meantime, people are unintentionally breeding pesticide-resistant pests. A process has begun where people become perpetual guardians of the affected area, which requires the expenditure of financial resources and human ingenuity to keep the system going. A second reason for protecting biological diversity is that it represents one of our greatest untapped resources. Great benefits can be reaped from a single species. About 20 species provide 90% of the world’s food. Of these 20, just three, wheat, maize, and rice-supply over one half of that food. American wheat farmers need new varieties every five to 15 years to compete with pests and diseases. Wild strains of wheat are critical genetic reservoirs for these new varieties. Further, every species is a potential source of human medicine. In 1980, a published report identified the market value of prescription drugs from higher plants at over $3 billion. Organic alkaloids, a class of NRI 2217 November 2022 11 chemical compounds used in medicines, are found in an estimated 20% of plant species. Yet only 2% of plant species have been screened for these compounds (Hoose 1981). The third reason for protecting diversity is that humans benefit from natural areas and depend on healthy ecosystems. The natural world supplies our air, our water, our food and supports human economic activity. Further, humans are creatures that evolved in a diverse natural environment between forest and grasslands. People need to be reassured that such places remain. When people speak of “going to the country,” they generally mean more than getting out of town. For reasons of their own sanity and wellbeing, they need a holistic, organic experience. Prolonged exposure to urban monotony produces neuroses, for which cultural and natural diversity cure. Historically, the lack of attention to biological diversity, and the ecological processes it supports, has resulted in economic hardships for segments of the basin’s human population. The final reason for protecting biological diversity is that species and natural systems are intrinsically valuable. The above reasons have focused on the benefits of the natural world to humans. All things possess intrinsic value simply because they exist. BIOLOGICAL RESOURCES CONCERNING THE SUBJECT PARCEL As part of the Natural Resources Information Report, staff checks office maps to determine if any nature preserves or ecologically sensitive areas are in the general vicinity of the parcel in question. If there is a nature preserve in the area, then that resource will be identified as part of the report. The SWCD recommends that every effort be made to protect that resource. Such efforts should include, but are not limited to erosion control, sediment control, stormwater management, and groundwater monitoring. ______________________________________________________________________________ 1Taken from The Conservation of Biological Diversity in the Great Lakes Ecosystem: Issues and Opportunities, prepared by the Nature Conservancy Great Lakes Program 79W. Monroe Street, Suite 1309, Chicago, IL 60603, January 1994. Office maps indicate that ecologically sensitive area(s) are located on or near the parcel in question (PIQ). Rob Roy Creek, a tributary to the Fox River, flows near the eastern boundary of the parcel. NRI 2217 November 2022 12 SOILS INFORMATION IMPORTANCE OF SOILS INFORMATION Soils information comes from the Natural Resources Conservation Service Soil Maps and Descriptions for Kendall County. This information is important to all parties involved in determining the suitability of the proposed land use change. Each soil polygon is given a number, which represents its soil type. The letter found after the soil type number indicates the soils slope class. Each soil map unit has limitations for a variety of land uses such as septic systems, buildings with basements, and buildings without basements. It is important to remember that soils do not function independently of each other. The behavior of a soil depends upon the physical properties of adjacent soil types, the presence of artificial drainage, soil compaction, and its position in the local landscape. The limitation categories (not limited, somewhat limited, or very limited) indicate the potential for difficulty in using that soil unit for the proposed activity and, thus, the degree of need for thorough soil borings and engineering studies. A limitation does not necessarily mean that the proposed activity cannot be done on that soil type. It does mean that the reasons for the limitation need to be thoroughly understood and dealt with to complete the proposed activity successfully. Very limited indicates that the proposed activity will be more difficult and costly to do on that soil type than on a soil type with a somewhat limited or not limited rating. Soil survey interpretations are predictions of soil behavior for specified land uses and specified management practices. They are based on the soil properties that directly influence the specified use of the soil. Soil survey interpretations allow users of soil surveys to plan reasonable alternatives for the use and management of soils. Soil interpretations do not eliminate the need for on-site study and testing of specific sites for the design and construction for specific uses. They can be used as a guide for planning more detailed investigations and for avoiding undesirable sites for an intended use. The scale of the maps and the range of error limit the use of the soil delineation. NRI 2217 November 2022 13 Figure 5: Soil Map Table 3: Soil Map Unit Descriptions Symbol Descriptions Acres Percent 134C2 Camden silt loam, 5-10% slopes, eroded 3.2 16.6% 149A Brenton silt loam, 0-2% slopes 3.5 18.4% 330A Peotone silty clay loam, 0-2% slopes 5.0 26.4% 668B Somonauk silt loam, 2-5% slopes 7.3 38.6% Source: National Cooperative Soil Survey – USDA-NRCS NRI 2217 November 2022 14 SOILS INTERPRETATIONS EXPLANATION GENERAL – NONAGRICULTURAL These interpretative ratings help engineers, planners, and others to understand how soil properties influence behavior when used for nonagricultural uses such as building site development or construction materials. This report gives ratings for proposed uses in terms of limitations and restrictive features. The tables list only the most restrictive features. Other features may need treatment to overcome soil limitations for a specific purpose. Ratings come from the soil's "natural" state, that is, no unusual modification occurs other than that which is considered normal practice for the rated use. Even though soils may have limitations, an engineer may alter soil features or adjust building plans for a structure to compensate for most degrees of limitations. Most of these practices, however, are costly. The final decision in selecting a site for a particular use generally involves weighing the costs for site preparation and maintenance. Soil properties influence development of building sites, including the selection of the site, the design of the structure, construction, performance after construction, and maintenance. Soil limitation ratings of not limited, somewhat limited, and very limited are given for the types of proposed improvements that are listed or inferred by the petitioner as entered on the report application and/or zoning petition. The most common types of building limitation that this report gives limitations ratings for is septic systems. It is understood that engineering practices can overcome most limitations for buildings with and without basements, and small commercial buildings. Limitation ratings for these types of buildings are not commonly provided. Organic soils, when present on the parcel, are referenced in the hydric soils section of the report. This type of soil is considered unsuitable for all types of construction. LIMIATIONS RATINGS xNot Limited: This soil has favorable properties for the use. The degree of limitation is minor. The people involved can expect good performance and low maintenance. xSomewhat Limited: This soil has moderately favorable properties for the use. Special planning, design, or maintenance can overcome this degree of limitation. During some part of the year, the expected performance is less desirable than for soils rated slight. xVery Limited: This soil has one or more properties that are unfavorable for the rated use. These may include the following: steep slopes, bedrock near the surface, flooding, high shrink-swell potential, a seasonal high water table, or low strength. This degree of limitation generally requires major soil reclamation, special design, or intensive maintenance, which in most situations is difficult and costly. NRI 2217 November 2022 15 BUILDING LIMITATIONS BUILDING ON POORLY SUITED OR UNSUITABLE SOILS Building on poorly suited or unsuitable soils can present problems to future property owners such as cracked foundations, wet basements, lowered structural integrity and high maintenance costs associated with these problems. The staff of the Kendall County SWCD strongly urges scrutiny by the plat reviewers when granting parcels with these soils exclusively. Solar Arrays, Soil-Based Anchor Systems – Ground-based solar arrays are sets of photovoltaic panels that are not situated on a building or pole. These installations consist of a racking system that holds the panel in the desired orientation and the foundation structures that hold the racking system to the ground. Two basic methods are used to hold the systems to the ground, based on site conditions and cost. One method employs driven piles, screw augers, or concrete piers that penetrate the soil to provide a stable foundation. Solar Arrays, Ballast Anchor Systems Ground-based solar arrays are sets of photovoltaic panels that are not situated on a building or pole. These installations consist of a racking system that holds the panel in the desired orientation and the foundation structures that hold the racking system to the ground. Ballast anchor systems can be used in some places where soil-penetrating systems cannot, such as in shallow or stony soil. Also, since they do not penetrate the soil, ballast systems can be used where the soil is contaminated, and disturbance is to be avoided. The soil in the area must have sufficient strength to be able to support the vehicles that haul the ballast and the machinery to install it. Shallow Excavations – Trenches or holes dug to a maximum depth of 5 or 6 feet for utility lines, open ditches, or other purposes. Ratings are based on soil properties that influence the ease of digging and the resistance to sloughing. Lawns and Landscaping – Require soils on which turf and ornamental trees and shrubs can be established and maintained (irrigation is not considered in the ratings). The ratings are based on the soil properties that affect plant growth and trafficability after vegetation is established. Local Roads and Streets – They have an all-weather surface and carry automobile and light truck traffic all year. They have a subgrade of cut or fill soil material, a base of gravel, crushed rock or soil material stabilized by lime or cement; and a surface of flexible material (asphalt), rigid material (concrete) or gravel with a binder. The ratings are based on the soil properties that affect the east of excavation and grading and the traffic-supporting capacity. NRI 2217 November 2022 16 Table 4: Building Limitations Soil Type Solar Arrays, Soil-Based Anchor Systems Solar Arrays, Ballast Anchor Systems Shallow Excavations Lawns & Landscaping Local Roads & Streets Acres % 134C2 Very Limited: Frost action Low strength Steel corrosion Shrink-swell Hillslope position Very Limited: Frost action Low strength Hillslope position Slope direction & gradient Somewhat Limited: Dusty Unstable excavation walls Somewhat Limited: Dusty Very Limited: Frost action Low strength Shrink-swell 3.2 16.6% 149A Very Limited: Frost action Low strength Steel corrosion Depth to saturated zone Hillslope position Very Limited: Frost action Low strength Depth to saturated zone Hillslope position Very Limited: Depth to saturated zone Dusty Unstable excavation walls Somewhat Limited: Depth to saturated zone Dusty Very Limited: Frost action Low strength Depth to saturated zone Shrink-swell 3.5 18.4% 330A Very Limited: Ponding Depth to saturated zone Shrink-swell Frost action Low strength Very Limited: Ponding Depth to saturated zone Frost action Low strength Slope shape across Very Limited: Ponding Depth to saturated zone Unstable excavation walls Dusty Too clayey Very Limited: Ponding Depth to saturated zone Dusty Very Limited: Ponding Depth to saturated zone Shrink-swell Frost action Low strength 5.0 26.4% 668B Very Limited: Frost action Steel corrosion Shrink-swell Low strength Hillslope position Very Limited: Frost action Low strength Hillslope position Slope shape across Somewhat Limited: Depth to saturated zone Dusty Unstable excavation walls Somewhat Limited: Dusty Very Limited: Frost action Shrink-swell Low strength 7.3 38.6% % Very Limited 100% 100% 44.8% 26.4% 100% NRI 2217 November 2022 17 NRI Report 2217 Map of Building Limitations: Solar Arrays (Soil-Based & Ballast Anchor Systems) and Local Roads & Streets (Paved & Unpaved) Natural Resources Conservation Service Web Soil Survey Location: SW ¼ Sec. 17, SE ¼ Sec. 18, T.37N-R.7E (Bristol Township) Legend Figure 6A: Map of Building Limitations – Solar Arrays (Soil-Based & Ballast Anchor Systems) and Local Roads & Streets (Paved & Unpaved) NRI 2217 November 2022 18 NRI Report 2217 Map of Building Limitations: Shallow Excavations Natural Resources Conservation Service Web Soil Survey Location: SW ¼ Sec. 17, SE ¼ Sec. 18 T.37N-R.7E (Bristol Township) Legend Figure 6B: Map of Building Limitations – Shallow Excavations NRI 2217 November 2022 19 NRI Report 2217 Map of Building Limitations: Lawns/Landscaping Natural Resources Conservation Service Web Soil Survey Location: SW ¼ Sec. 17, SE ¼ Sec. 18 T.37N-R.7E (Bristol Township) Legend Figure 6C: Map of Building Limitations – Lawns/Landscaping NRI 2217 November 2022 20 SOIL WATER FEATURES Table 5, below, gives estimates of various soil water features that should be taken into consideration when reviewing engineering for a land use project. HYDROLOGIC SOIL GROUPS (HSGs) – The groups are based on estimates of runoff potential. Soils are assigned to one of four groups according to the rate of water infiltration when the soils are not protected by vegetation, are thoroughly wet, and receive precipitation from long-duration storms. xGroup A: Soils having a high infiltration rate (low runoff potential) when thoroughly wet. These consist mainly of deep, well drained to excessively drained sands or gravelly sands. These soils have a high rate of water transmission. xGroup B: Soils having a moderate infiltration rate when thoroughly wet. These consist chiefly of moderately deep or deep, moderately well drained, or well drained soils that have moderately fine texture to moderately coarse texture. These soils have a moderate rate of water transmission. xGroup C: Soils having a slow infiltration rate when thoroughly wet. These consist chiefly of soils having a layer that impedes the downward movement of water or soils of moderately fine texture or fine texture. These soils have a slow rate of water transmission. xGroup D: Soils having a very slow infiltration rate (high runoff potential) when thoroughly wet. These consist chiefly of clays that have a high shrink-swell potential, soils that have a high water table, soils that have a claypan or clay layer at or near the surface, and soils that are shallow over nearly impervious material. These soils have a very slow rate of water transmission. Note: If a soil is assigned to a dual hydrologic group (A/D, B/D or C/D) the first letter is for drained areas and the second is for undrained areas. SURFACE RUNOFF – Surface runoff refers to the loss of water from an area by flow over the land surface. Surface runoff classes are based upon slope, climate and vegetative cover and indicates relative runoff for very specific conditions (it is assumed that the surface of the soil is bare and that the retention of surface water resulting from irregularities in the ground surface is minimal). The classes are negligible, very low, low, medium, high, and very high. MONTHS – The portion of the year in which a water table, ponding, and/or flooding is most likely to be a concern. WATER TABLE – Water table refers to a saturated zone in the soil and the data indicates, by month, depth to the top (upper limit) and base (lower limit) of the saturated zone in most years. These estimates are based upon observations of the water table at selected sites and on evidence of a saturated zone (grayish colors or mottles (redoximorphic features)) in the soil. Note: A saturated zone that lasts for less than a month is not considered a water table. PONDING – Ponding refers to standing water in a closed depression, and the data indicates surface water depth, duration, and frequency of ponding. NRI 2217 November 2022 21 xDuration: Expressed as very brief if less than 2 days, brief if 2 to 7 days, long if 7 to 30 days and very long if more than 30 days. xFrequency: Expressed as: none meaning ponding is not possible; rare means unlikely but possible under unusual weather conditions (chance of ponding is 0-5% in any year); occasional means that it occurs, on the average, once or less in 2 years (chance of ponding is 5 to 50% in any year); and frequent means that it occurs, on the average, more than once in 2 years (chance of ponding is more than 50% in any year). FLOODING – The temporary inundation of an area caused by overflowing streams, by runoff from adjacent slopes, or by tides. Water standing for short periods after rainfall or snowmelt is not considered flooding, and water standing in swamps and marshes is considered ponding rather than flooding. xDuration: Expressed as: extremely brief if 0.1 hour to 4 hours; very brief if 4 hours to 2 days; brief if 2 to 7 days; long if 7 to 30 days; and very long if more than 30 days. xFrequency: Expressed as: none means flooding is not probable; very rare means that it is very unlikely but possible under extremely unusual weather conditions (chance of flooding is less than 1% in any year); rare means that it is unlikely but possible under unusual weather conditions (chance of flooding is 1 to 5% in any year); occasional means that it occurs infrequently under normal weather conditions (chance of flooding is 5 to 50% in any year but is less than 50% in all months in any year); and very frequent means that it is likely to occur very often under normal weather conditions (chance of flooding is more than 50% in all months of any year). Note: The information is based on evidence in the soil profile. In addition, consideration is also given to local information about the extent and levels of flooding and the relation of each soil on the landscape to historic floods. Information on the extent of flooding based on soil data is less specific than that provided by detailed engineering surveys that delineate flood-prone areas at specific flood frequency levels. Table 5: Water Features Map Unit Hydrologic Group Surface Runoff Water Table Ponding Flooding 134C2 B Medium January – December Upper Limit: -- Lower Limit: -- January – December Surface Water Depth: -- Duration: -- Frequency: -- January – December Duration: -- Frequency: None 149A B/D Low January - May Upper Limit: 1.0’-2.0’ Lower Limit: 6.0’ June – December Upper Limit: -- Lower Limit: -- January – December Surface Water Depth: -- Duration: -- Frequency: -- January – December Duration: -- Frequency: None 330A C/D Negligible January - June Upper Limit: 0.0’-1.0’ Lower Limit: 6.0’ July – December Upper Limit: -- Lower Limit: -- January – June Surface Water Depth: 0.0’-0.5’ Duration: Brief (2 to 7 days) Frequency: Frequent July – December Surface Water Depth: -- Duration: -- Frequency: -- January – December Duration: -- Frequency: None NRI 2217 November 2022 22 Map Unit Hydrologic Group Surface Runoff Water Table Ponding Flooding 668B C Low January Upper Limit: -- Lower Limit: -- February – April Upper Limit: 2.0-3.5’ Lower Limit: 6.0’ May – December Upper Limit: -- Lower Limit: -- January – December Surface Water Depth: -- Duration: -- Frequency: -- January – December Duration: -- Frequency: None NRI 2217 November 2022 23 SOIL EROSION AND SEDIMENT CONTROL Erosion is the wearing away of the soil by water, wind, and other forces. Soil erosion threatens the Nation's soil productivity and contributes the most pollutants in our waterways. Water causes about two thirds of erosion on agricultural land. Four properties, mainly, determine a soil's erodibility: texture, slope, structure, and organic matter content. Slope has the most influence on soil erosion potential when the site is under construction. Erosivity and runoff increase as slope grade increases. The runoff then exerts more force on the particles, breaking their bonds more readily and carrying them farther before deposition. The longer water flows along a slope before reaching a major waterway, the greater the potential for erosion. Soil erosion during and after this proposed construction can be a primary non-point source of water pollution. Eroded soil during the construction phase can create unsafe conditions on roadways, decrease the storage capacity of lakes, clog streams and drainage channels, cause deterioration of aquatic habitats, and increase water treatment costs. Soil erosion also increases the risk of flooding by choking culverts, ditches, and storm sewers and by reducing the capacity of natural and man-made detention facilities. The general principles of erosion and sedimentation control measures include: xReducing/diverting flow from exposed areas, storing flows, or limiting runoff from exposed areas xStaging construction to keep disturbed areas to a minimum xEstablishing or maintaining temporary or permanent groundcover xRetaining sediment on site xProperly installing, inspecting, and maintaining control measures Erosion control practices are useful controls only if they are properly located, installed, inspected, and maintained. Soil erosion and sedimentation control plans, including maintenance responsibilities, should be clearly communicated to all contractors working on the site. The SWCD recommends an erosion and sediment control plan for all building sites, especially if there is a wetland or stream nearby. Additionally, a National Pollutant Discharge Elimination System (NPDES) permit (Permit No. ILR10) from the Illinois Environmental Protection Agency (IEPA) is required for stormwater discharges from construction sites that will disturb 1 or more acres of land. Conditions of the NPDES ILR10 permit require the development and implementation of a Stormwater Pollution Prevention Plan (SWPPP) to reduce stormwater pollutants on the construction site before they can cause environmental issues. Table 6: Soil Erosion Potential Soil Type Slope Rating Acreage Percent of Parcel 134C2 5-10% Moderate 3.2 16.6% 149A 0-2% Slight 3.5 18.4% 330A 0-2% Slight 5.0 26.4% 668B 2-5% Slight 7.3 38.6% NRI 2217 November 2022 24 PRIME FARMLAND SOILS Prime farmland soils are an important resource to Kendall County. Some of the most productive soils in the United States occur locally. Each soil map unit in the United States is assigned a prime or non-prime rating. Prime agricultural land does not need to be in the production of food & fiber. Section 310 of the NRCS general manual states that urban or built-up land on prime farmland soils is not prime farmland. The percentages of soil map units on the parcel reflect the determination that urban or built up land on prime farmland soils is not prime farmland. Table 7: Prime Farmland Soils Soil Types Prime Designation Acreage Percent 134C2 Farmland of Statewide Importance 3.2 16.6% 149A Prime Farmland 3.5 18.4% 330A Prime Farmland if Drained 5.0 26.4% 668B Prime Farmland 7.3 38.6% % Prime Farmland 100% Figure 7: Map of Prime Farmland Soils NRI 2217 November 2022 25 LAND EVALUATION AND SITE ASSESSMENT (LESA) Decision-makers in Kendall County use the Land Evaluation and Site Assessment (LESA) system to determine the suitability of a land use change and/or a zoning request as it relates to agricultural land. The LESA system was developed by the United States Department of Agriculture-Natural Resources Conservation Service (USDA-NRCS) and takes into consideration local conditions such as physical characteristics of the land, compatibility of surrounding land-uses, and urban growth factors. The LESA system is a two-step procedure that includes: LAND EVALUATION (LE) The soils of a given area are rated and placed in groups ranging from the best to worst suited for a stated agriculture use, cropland, or forestland. The best group is assigned a value of 100, and all other groups are assigned lower values. The Land Evaluation is based on data from the Kendall County Soil Survey. The LE score is calculated by multiplying the relative value of each soil type by the number of acres of that soil. The sum of the products is then divided by the total number of acres; the answer is the Land Evaluation score on this site. The Kendall County Soil and Water Conservation District is responsible for this portion of the LESA system. SITE ASSESSMENT (SA) The site is numerically evaluated according to important factors that contribute to the quality of the site. Each factor selected is assigned values in accordance with the local needs and objectives. The value group is a predetermined value based upon prime farmland designation. The Kendall County LESA Committee is responsible for this portion of the LESA system. Please Note: A land evaluation (LE) score will be compiled for every project parcel. However, when a parcel is located within municipal planning boundaries, a site assessment (SA) score is not compiled as the scoring factors are not applicable. As a result, only the LE score is available, and a full LESA score is unavailable for the parcel. Table 8: Land Evaluation Computation Soil Type Value Group Relative Value Acres Product (Relative Value x Acres) 134C2 5 82 3.2 262.4 149A 1 100 3.5 350.0 330A 3 87 5.0 435.0 668B 4 79 7.3 576.7 Totals 19.0 1,624.1 LE Calculation (Product of relative value / Total Acres) 1,624.1 / 19.0 = 85.4 LE Score LE = 85 The Land Evaluation score for this site is 85 out of 100, indicating that the soils are well suited for agricultural uses considering the Land Evaluation score is above 80. NRI 2217 November 2022 26 The Land Evaluation (LE) score for this site is 85, indicating that the soils are well suited for agricultural uses. The full LESA Score is not applicable for the proposed project site since it is within municipal planning boundaries. Note: Selecting the project site with the lowest total points will generally protect the best farmland located in the most viable areas and maintain and promote the agricultural industry in Kendall County. NRI 2217 November 2022 27 LAND USE PLANS Many counties, municipalities, villages, and townships have developed land-use plans. These plans are intended to reflect the existing and future land-use needs of a given community. Please contact the City of Yorkville’s Community Development Department for information regarding the City’s comprehensive land use plan and map. DRAINAGE, RUNOFF, AND FLOOD INFORMATION U.S.G.S Topographic maps give information on elevations, which are important mostly to determine slopes, drainage directions, and watershed information. Elevations determine the area of impact of floods of record. Slope information determines steepness and erosion potential. Drainage directions determine where water leaves the PIQ, possibly impacting surrounding natural resources. Watershed information is given for changing land use to a subdivision type of development on parcels greater than 10 acres. WHAT IS A WATERSHED? Simply stated, a watershed is the area of land that contributes water to a certain point. The watershed boundary is important because the area of land in the watershed can now be calculated using an irregular shape area calculator such as a dot counter or planimeter. Using regional storm event information, and site-specific soils and land use information, the peak stormwater flow through the point marked “{” for a specified storm event can be calculated. This value is called a “Q” value (for the given storm event) and is measured in cubic feet per second (CFS). When construction occurs, the Q value naturally increases because of the increase in impermeable surfaces. This process decreases the ability of soils to accept and temporarily hold water. Therefore, more water runs off and increases the Q value. Theoretically, if each development, no matter how large or small, maintains their preconstruction Q value after construction by the installation of stormwater management systems, the streams and wetlands and lakes will not suffer damage from excessive urban stormwater. For this reason, the Kendall County SWCD recommends that the developer for intense uses such as a subdivision calculate the preconstruction Q value for the exit point(s). A stormwater management system NRI 2217 November 2022 28 should be designed, installed, and maintained to limit the postconstruction Q value to be at or below the preconstruction value. IMPORTANCE OF FLOOD INFORMATION A floodplain is defined as land adjoining a watercourse (riverine) or an inland depression (non-riverine) that is subject to periodic inundation by high water. Floodplains are important areas demanding protection since they have water storage and conveyance functions which affect upstream and downstream flows, water quality and quantity, and suitability of the land for human activity. Since floodplains play distinct and vital roles in the hydrologic cycle, development that interferes with their hydrologic and biologic functions should be carefully considered. Flooding is both dangerous to people and destructive to their properties. The following maps, when combined with wetland and topographic information, can help developers and future homeowners to “sidestep” potential flooding or ponding problems. FIRM is the acronym for the Flood Insurance Rate Map, produced by the Federal Emergency Management Agency (FEMA). These maps define flood elevation adjacent to tributaries and major bodies of water and superimpose that onto a simplified USGS topographic map. The scale of the FIRM maps is generally dependent on the size and density of parcels in that area. (This is to correctly determine the parcel location and floodplain location.) The FIRM map has three (3) zones. Zone A includes the 100-year flood, Zone B or Zone X (shaded) is the 100 to 500-year flood, and Zone C or Zone X (unshaded) is outside the floodplain. The Hydrologic Atlas (H.A.) Series of the Flood of Record Map is also used for the topographic information. This map is different from the FIRM map mainly because it will show isolated or pocketed flooded areas. Kendall County uses both these maps in conjunction with each other for flooded area determinations. The Flood of Record maps show the areas of flood for various years. Both maps stress that the recurrence of flooding is merely statistical. A 100-year flood may occur twice in one year, or twice in one week, for that matter. It should be noted that greater floods than those shown on the two maps are possible. The flood boundaries indicated provide a historic record only until the map publication date. Additionally, these flood boundaries are a function of the watershed conditions existing when the maps were produced. Cumulative changes in runoff characteristics caused by urbanization can result in an increase in flood height of future flood episodes. Floodplains play a vital role in reducing the flood damage potential associated with an urbanizing area and, when left in an undisturbed state, also provide valuable wildlife habitat benefits. If it is the petitioner's intent to conduct floodplain filling or modification activities, the petitioner, and the Unit of Government responsible need to consider the potentially adverse effects this type of action could have on adjacent properties. The change or loss of natural floodplain storage often increases the frequency and severity of flooding on adjacent property. NRI 2217 November 2022 29 If the available maps indicate the presence of a floodplain on the PIQ, the petitioner should contact the IDNR-OWR and FEMA to delineate a floodplain elevation for the parcel. If a portion of the property is indeed floodplain, applicable state, county, and local regulations will need to be reflected in the site plans. Another indication of flooding potential can be found in the soils information. Hydric soils indicate the presence of drainageways, areas subject to ponding, or a naturally occurring high water table. These need to be considered along with the floodplain information when developing the site plan and the stormwater management plan. Development on hydric soils can contribute to the loss of water storage within the soil and the potential for increased flooding in the area. Figure 8: FEMA Floodplain Map This parcel is located on minimal topography (slopes 0 to 10%) and an elevation range of approximately 638’-644’ above sea level. According to the FEMA Floodplain Map (Figure 8), the parcel in question is located outside of the 100-year floodplain. It is mapped as Zone X, an area of minimal flood hazard. NRI 2217 November 2022 30 Figure 9: Topographic Map NRI 2217 November 2022 31 WATERSHED PLANS WATERSHED AND SUB WATERSHED INFORMATION A watershed is the area of land that drains into a specific point including a stream, lake, or other body of water. High points on the Earth’s surface, such as hills and ridges define watersheds. When rain falls in the watershed, it flows across the ground towards a stream or lake. Rainwater carries pollutants such as oils, pesticides, and soil. Everyone lives in a watershed. Their actions can impact natural resources and people living downstream. Residents can minimize this impact by being aware of their environment and the implications of their activities, implementing practices recommended in watershed plans, and educating others about their watershed. The following are recommendations to developers for protection of this watershed: xPreserve open space xMaintain wetlands as part of development xUse natural water management xPrevent soil from leaving a construction site xProtect subsurface drainage xUse native vegetation xRetain natural features xMix housing styles and types xDecrease impervious surfaces xReduce area disturbed by mass grading xShrink lot size and create more open space xMaintain historical and cultural resources xTreat water where it falls xPreserve views xEstablish and link trails This parcel is located within the Fox River watershed and the Rob Roy Creek sub watershed. NRI 2217 November 2022 32 WETLAND INFORMATION IMPORTANCE OF WETLAND INFORMATION Wetlands function in many ways to provide numerous benefits to society. They control flooding by offering a slow release of excess water downstream or through the soil. They cleanse water by filtering out sediment and some pollutants and can function as rechargers of our valuable groundwater. They also are essential breeding, rearing, and feeding grounds for many species of wildlife. These benefits are particularly valuable in urbanizing areas as development activity typically adversely affects water quality, increases the volume of stormwater runoff, and increases the demand for groundwater. In an area where many individual homes rely on shallow groundwater wells for domestic water supplies, activities that threaten potential groundwater recharge areas are contrary to the public good. The conversion of wetlands, with their sediment trapping and nutrient absorbing vegetation, to biologically barren stormwater detention ponds can cause additional degradation of water quality in downstream or adjacent areas. It has been estimated that over 95% of the wetlands that were historically present in Illinois have been destroyed while only recently has the true environmental significance of wetlands been fully recognized. America is losing 100,000 acres of wetland a year and has saved 5 million acres total (since 1934). One acre of wetland can filter 7.3 million gallons of water a year. These are reasons why our wetlands are high quality and important. This section contains the National Wetlands Inventory, which is the most comprehensive inventory to date. The National Wetlands Inventory is reproduced from an aerial photo at a scale of 1” equals 660 feet. The NRCS developed these maps in cooperation with U.S. EPA (Environmental Protection Agency,) and the U.S. Fish and Wildlife Service, using the National Food Security Act Manual, 3rd Edition. The main purpose of these maps is to determine wetland areas on agricultural fields and areas that may be wetlands but are in a non-agriculture setting. The National Wetlands Inventory in no way gives an exact delineation of the wetlands, but merely an outline, or the determination that there is a wetland within the outline. For the final, most accurate wetland determination of a specific wetland, a wetland delineation must be certified by NRCS staff using the National Food Security Act Manual (on agricultural land.) On urban land, a certified wetland delineator must perform the delineation using the ACOE 1987 Manual. See the glossary section for the definitions of “delineation” and “determination. NRI 2217 November 2022 33 Figure 10: Wetland Map – USFWS National Wetlands Inventory Office maps indicate that mapped wetlands/waters are not present on the parcel in question (PIQ). Please note that a Wetland Delineation Report dated July 22, 2022 was prepared by ENCAP, Inc. The results of their on-site investigation indicated the presence of two farmed wetlands within the project area. One off-site wetland (Rob Roy Creek) was also identified. NRI 2217 November 2022 34 HYDRIC SOILS Soils information gives another indication of flooding potential. The soils map on the following page indicates the soil(s) on the parcel that the Natural Resources Conservation Service indicates as hydric. Hydric soils, by definition, have seasonal high water at or near the soil surface and/or have potential flooding or ponding problems. All hydric soils range from poorly suited to unsuitable for building. One group of the hydric soils are the organic soils, which formed from dead organic material. Organic soils are unsuitable for building because of not only the high water table but also their subsidence problems. It is important to add the possibility of hydric inclusions in a soil type. An inclusion is a soil polygon that is too small to appear on these maps. While relatively insignificant for agricultural use, hydric soil inclusions become more important to more intense uses such as a residential subdivision. While considering hydric soils and hydric inclusions, it is noteworthy to mention that subsurface agriculture drainage tile occurs in almost all poorly drained and somewhat poorly drained soils. Drainage tile expedites drainage and facilitates farming. It is imperative that these drainage tiles remain undisturbed. A damaged subsurface drainage tile may return original hydrologic conditions to all the areas that drained through the tile (ranging from less than one acre to many square miles.) For an intense land use, such as a subdivision, the Kendall County SWCD recommends the following: a topographical survey with 1 foot contour intervals to accurately define the flood area on the parcel, an intensive soil survey to define most accurately the locations of the hydric soils and inclusions, and a drainage tile survey on the area to locate the tiles that must be preserved to maintain subsurface drainage. Table 9: Hydric Soils Soil Types Drainage Class Hydric Designation Hydric Inclusions Likely Acreage Percent 134C2 Well Drained Non-Hydric Yes 3.2 16.6% 149A Somewhat Poorly Drained Non-Hydric Yes 3.5 18.4% 330A Very Poorly Drained Hydric No 5.0 26.4% 668B Moderately Well Drained Non-Hydric No 7.3 38.6% NRI 2217 November 2022 35 Figure 11: Hydric Soil Map NRI 2217 November 2022 36 WETLAND AND FLOODPLAIN REGULATIONS The laws of the United States and the State of Illinois assign certain agencies specific and different regulatory roles to protect the waters within the State's boundaries. These roles, when considered together, include protection of navigation channels and harbors, protection against floodway encroachments, maintenance and enhancement of water quality, protection of fish and wildlife habitat and recreational resources, and, in general, the protection of total public interest. Unregulated use of the waters within the State of Illinois could permanently destroy or alter the character of these valuable resources and adversely impact the public. Therefore, please contact the proper regulatory authorities when planning any work associated with Illinois waters so that proper consideration and approval can be obtained. WHO MUST APPLY? Anyone proposing to dredge, fill, rip rap, or otherwise alter the banks or beds of, or construct, operate, or maintain any dock, pier, wharf, sluice, dam, piling, wall, fence, utility, floodplain or floodway subject to State or Federal regulatory jurisdiction should apply for agency approvals. REGULATORY AGENCIES xWetland or U.S. Waters: U.S. Army Corps of Engineers, Rock Island District, Clock Tower Building, Rock Island, IL xFloodplains: Illinois Department of Natural Resources/Office of Water Resources, One Natural Resources Way, Springfield, IL 62702-1270. xWater Quality/Erosion Control: Illinois Environmental Protection Agency, Springfield, IL COORDINATION We recommend early coordination with the regulatory agencies BEFORE finalizing work plans. This allows the agencies to recommend measures to mitigate or compensate for adverse impacts. Also, the agency can make possible environmental enhancement provisions early in the project planning stages. This could reduce time required to process necessary approvals. PLEASE READ THE FOLLOWING IF YOU ARE PLANNING TO DO ANY WORK NEAR A STREAM (THIS INCLUDES SMALL UNNAMED STREAMS), LAKE, WETLAND OR FLOODWAY. CAUTION: Contact with the United States Army Corps of Engineers is strongly advised before commencement of any work in or near a Waters of the United States. This could save considerable time and expense. Persons responsible for willful and direct violation of Section 10 of the River and Harbor Act of 1899 or Section 404 of the Federal Water Pollution Control Act are subject to fines ranging up to $27,500 per day of violation and imprisonment for up to one year or both. NRI 2217 November 2022 37 GLOSSARY AGRICULTURAL PROTECTION AREAS (AG AREAS) - Allowed by P.A. 81-1173. An AG AREA consists of a minimum of 350 acres of farmland, as contiguous and compact as possible. Petitioned by landowners, AG AREAS protect for a period of ten years initially, then reviewed every eight years thereafter. AG AREA establishment exempts landowners from local nuisance ordinances directed at farming operations, and designated land cannot receive special tax assessments on public improvements that do not benefit the land, e.g. water and sewer lines. AGRICULTURE - The growing, harvesting and storing of crops including legumes, hay, grain, fruit and truck or vegetable including dairying, poultry, swine, sheep, beef cattle, pony and horse production, fur farms, and fish and wildlife farms; farm buildings used for growing, harvesting and preparing crop products for market, or for use on the farm; roadside stands, farm buildings for storing and protecting farm machinery and equipment from the elements, for housing livestock or poultry and for preparing livestock or poultry products for market; farm dwellings occupied by farm owners, operators, tenants or seasonal or year around hired farm workers. B.G. - Below Grade. Under the surface of the Earth. BEDROCK - Indicates depth at which bedrock occurs. Also lists hardness as rippable or hard. FLOODING - Indicates frequency, duration, and period during year when floods are likely to occur. HIGH LEVEL MANAGEMENT - The application of effective practices adapted to different crops, soils, and climatic conditions. Such practices include providing for adequate soil drainage, protection from flooding, erosion and runoff control, near optimum tillage, and planting the correct kind and amount of high-quality seed. Weeds, diseases, and harmful insects are controlled. Favorable soil reaction and near optimum levels of available nitrogen, phosphorus, and potassium for individual crops are maintained. Efficient use is made of available crop residues, barnyard manure, and/or green manure crops. All operations, when combined efficiently and timely, can create favorable growing conditions and reduce harvesting losses -- within limits imposed by weather. HIGH WATER TABLE - A seasonal high water table is a zone of saturation at the highest average depth during the wettest part of the year. May be apparent, perched, or artesian kinds of water tables. xWater table, Apparent: A thick zone of free water in the soil. An apparent water table is indicated by the level at which water stands in an uncased borehole after adequate time is allowed for adjustment in the surrounding soil. xWater table, Artesian: A water table under hydrostatic head, generally beneath an impermeable layer. When this layer is penetrated, the water level rises in an uncased borehole. xWater table, Perched: A water table standing above an unsaturated zone. In places an upper, or perched, water table is separated from a lower one by a dry zone. NRI 2217 November 2022 38 DELINEATION - For Wetlands: A series of pink or orange flags placed on the ground by a certified professional that outlines the wetland boundary on a parcel. DETERMINATION - A polygon drawn on a map using map information that gives an outline of a wetland. HYDRIC SOIL - This type of soil is saturated, flooded, or ponded long enough during the growing season to develop anaerobic conditions in the upper part (USDA Natural Resources Conservation Service 1987). INTENSIVE SOIL MAPPING - Mapping done on a smaller more intensive scale than a modern soil survey to determine soil properties of a specific site, e.g. mapping for septic suitability. LAND EVALUATION AND SITE ASSESSMENT (L.E.S.A.) - LESA is a systematic approach for evaluating a parcel of land and to determine a numerical value for the parcel for farmland preservation purposes. MODERN SOIL SURVEY - A soil survey is a field investigation of the soils of a specific area, supported by information from other sources. The kinds of soil in the survey area are identified and their extent shown on a map, and an accompanying report describes, defines, classifies, and interprets the soils. Interpretations predict the behavior of the soils under different used and the soils' response to management. Predictions are made for areas of soil at specific places. Soils information collected in a soil survey is useful in developing land-use plans and alternatives involving soil management systems and in evaluating and predicting the effects of land use. PALUSTRINE - Name given to inland freshwater wetlands. PERMEABILITY - Values listed estimate the range (in rate and time) it takes for downward movement of water in the major soil layers when saturated but allowed to drain freely. The estimates are based on soil texture, soil structure, available data on permeability and infiltration tests, and observation of water movement through soils or other geologic materials. PIQ - Parcel in question POTENTIAL FROST ACTION - Damage that may occur to structures and roads due to ice lens formation causing upward and lateral soil movement. Based primarily on soil texture and wetness. PRIME FARMLAND - Prime farmland soils are lands that are best suited to food, feed, forage, fiber and oilseed crops. It may be cropland, pasture, woodland, or other land, but it is not urban and built up land or water areas. It either is used for food or fiber or is available for those uses. The soil qualities, growing season, and moisture supply are those needed for a well-managed soil economically to produce a sustained high yield of crops. Prime farmland produces in highest yields with minimum inputs of energy and economic resources and farming the land results in the least damage to the environment. Prime farmland has an adequate and dependable supply of moisture from precipitation or irrigation. The temperature and growing season are favorable. The level of acidity or alkalinity is acceptable. Prime farmland has few or no rocks and is permeable to water and air. It is not excessively erodible or saturated NRI 2217 November 2022 39 with water for long periods and is not frequently flooded during the growing season. The slope ranges mainly from 0 to 5 percent (USDA Natural Resources Conservation Service). SEASONAL - When used in reference to wetlands indicates that the area is flooded only during a portion of the year. SHRINK-SWELL POTENTIAL - Indicates volume changes to be expected for the specific soil material with changes in moisture content. SOIL MAPPING UNIT - A map unit is a collection of soil areas of miscellaneous areas delineated in mapping. A map unit is generally an aggregate of the delineations of many different bodies of a kind of soil or miscellaneous area but may consist of only one delineated body. Taxonomic class names and accompanying phase terms are used to name soil map units. They are described in terms of ranges of soil properties within the limits defined for taxa and in terms of ranges of taxadjuncts and inclusions. SOIL SERIES - A group of soils, formed from a particular type of parent material, having horizons that, except for texture of the A or surface horizon, are similar in all profile characteristics and in arrangement in the soil profile. Among these characteristics are color, texture, structure, reaction, consistence, and mineralogical and chemical composition. SUBSIDENCE - Applies mainly to organic soils after drainage. Soil material subsides due to shrinkage and oxidation. TERRAIN - The area or surface over which a particular rock or group of rocks is prevalent. TOPSOIL - That portion of the soil profile where higher concentrations of organic material, fertility, bacterial activity and plant growth take place. Depths of topsoil vary between soil types. WATERSHED - An area of land that drains to an associated water resource such as a wetland, river or lake. Depending on the size and topography, watersheds can contain numerous tributaries, such as streams and ditches, and ponding areas such as detention structures, natural ponds and wetlands. WETLAND - An area that has a predominance of hydric soils and that is inundated or saturated by surface or groundwater at a frequency and duration sufficient enough to support, and under normal circumstances does support, a prevalence of hydrophytic vegetation typically adapted for life in saturated soil conditions. NRI 2217 November 2022 40 REFERENCES Hydric Soils of the United States. USDA Natural Resources Conservation Service, 2007. FIRM – Flood Insurance Rate Maps for Kendall County. Prepared by FEMA – Federal Emergency Management Agency. Hydrologic Unit Map for Kendall County. Natural Resources Conservation Service, United States Department of Agriculture. Land Evaluation and Site Assessment System. The Kendall County Department of Planning Building and Zoning, and The Kendall County Soil and Water Conservation District. In cooperation with: USDA, Natural Resources Conservation Service. Soil Survey of Kendall County. United States Department of Agriculture 2008, Natural Resources Conservation Service. Illinois Urban Manual. Association of Illinois Soil & Water Conservation Districts, 2020. Kendall County Land Atlas and Plat Book. 21st Edition, 2021. Potential For Contamination of Shallow Aquifers from Land Burial of Municipal Wastes. Illinois State Geological Survey. Natural Resources Conservation Service National Wetland Inventory Map. United States Department of Agriculture. Geologic Road Map of Illinois. Department of Natural Resources, Illinois State Geological Survey, Natural Resources Building, 615 East Peabody, Champaign IL 61820-6964. Wetlands - The Corps of Engineers' Administration of the Section 404 Program (GAO/RCED-88-110). Soil Erosion by Water - United States Department of Agriculture Natural Resources Conservation Service. Agriculture Information Bulletin 513. The Conservation of Biological Diversity in the Great Lakes Ecosystem: Issues and Opportunities, prepared by the Nature Conservancy Great Lakes Program 79W. Monroe Street, Suite 1309, Chicago, IL 60603, January 1994. 1 STATE OF ILLINOIS ) ) ss. COUNTY OF KENDALL ) ANNEXATION AGREEMENT This Annexation Agreement (hereinafter (“Agreement”), is made and entered into this _____ day of __________, 2023, by and between the United City of Yorkville, a municipal corporation, hereinafter referred to as “City” and Robert M. and Ildefonsa Loftus, hereinafter jointly referred to as “Owner”. WITNESSETH: WHEREAS, the Owner owns fee simple interest to the real property, which is legally described in Exhibit A attached hereto, consisting of approximately 27.63 acres, more or less (the “Subject Property”); and, WHEREAS, it is the desire of the Owner to provide for the annexation of the Subject Property and to use the Subject Property in accordance with the terms of this Agreement and the ordinances of the City; and, to provide that when annexed, the Subject Property is to be zoned as A-1 Agricultural District with a special use for a solar farm; and, WHEREAS, it is the desire of the Mayor and City Council (the “Corporate Authorities”) to annex the Subject Property and permit the solar farm as a special use, all being pursuant to the terms and conditions of this Agreement and the ordinances of the City; and, WHEREAS, Owner and City have or will perform and execute all acts required by law to effectuate such annexation; and, WHEREAS, all notices and publications as required by law relating to the zoning and special use of the Subject Property and the Agreement have been published and given to the persons or entities entitled thereto, pursuant to the applicable provisions of the Illinois Municipal Code (the “Municipal Code”); and, WHEREAS, the Corporate Authorities of the City have duly fixed the time for a public hearing on this Agreement and pursuant to legal notice have held such hearing thereon all as required by the provisions of the Municipal Code; and, WHEREAS, the Planning and Zoning Commission of the City and has duly held all public hearings relating to zoning and special use for the solar farm, all as required by the provisions of the City’s Zoning Code and the Municipal Code (the “Municipal Code”); and, 2 WHEREAS, the Owner and City agree that upon Annexation to the City of the Subject Property shall be placed in the A-1 Agricultural District; and, WHEREAS, in accordance with the powers granted to the City by the provisions of Section 11-15.1-1 et seq. of the Municipal Code (65 ILCS 5/11-15.1-1 et seq.), relating to Annexation Agreements, the parties hereto wish to enter into a binding Agreement with respect to the future annexation, and zoning of the Subject Property and to provide for various other matters related directly or indirectly to the annexation and use of the Subject Property during the term of this Agreement as authorized by the provisions of said statutes. NOW THEREFORE, in consideration of the mutual covenants, agreements and conditions herein contained, and by authority of and in accordance with the aforesaid statutes of the State of Illinois, the City and the Owner agree as follows: Section 1. Annexation. The Owner has filed with the Clerk of the City a duly and properly executed petition pursuant to, and in accordance with, the provisions of Section 5/7-1-1 et seq. of the Municipal Code to annex the Subject Property and any adjacent roadways not previously annexed to the City of Yorkville. Section 2. Zoning. A. The City hereby agrees, contemporaneously with annexation, the Subject Property shall be classified and shall be zoned as A-1 Agricultural District. B. The City and the Owner agree that annexation is contingent upon approval of a special use application for a solar farm which will be considered contemporaneously with the petition for annexation and rezoning submitted to the City. Section 3. Binding Effect and Term. This Annexation Agreement shall be binding upon and inure to the benefit of the parties hereto, their successors and assigns including, but not limited to, successor owners of record, successor developers, lessees and successor lessees, and upon any successor municipal authority of the City and the successor municipalities for a period of twenty (20) years from the later of the date of execution hereof and the date of adoption of the ordinances pursuant hereto. Section 4. Notices and Remedies. Upon a breach of this Agreement, the parties hereto agree that the venue shall be the Circuit Court of Kendall County. It is further understood by the parties hereto that upon breach of this Agreement the non-defaulting party may exercise any remedy available at law or equity. 3 Before any failure of any part of this Agreement to perform its obligations under this Agreement shall be deemed to be a breach of this Agreement, the party claiming such failure shall notify, in writing, by certified mail/return receipt requested, the party alleged to have failed to perform, state the obligation allegedly not performed and the performance demanded. Notice shall be provided at the following addresses: To the City: United City of Yorkville 800 Game Farm Road Yorkville, Illinois 60560 Attn: City Administrator With a copy to: Kathleen Field Orr Law Office of Kathleen Field Orr 2024 Hickory Road Suite 205 Homewood, Illinois 60430 To the Owner: Robert M. and Ildefonsa Loftus 11159 Faxon Road Yorkville, IL, 60560 To the Lessee: Dean Smith New Leaf Energy Inc. Beecher Solar 1, LLC 55 Technology Drive Suite 102 Lowell, MA 01851 Section 6. Agreement to Prevail over Ordinances. In the event of any conflict between this Agreement and any ordinances of the City in force at the time of execution of this Agreement or enacted during the pendency of this Agreement, the provisions of this Agreement shall prevail to the of any such conflict or inconsistency. Section 7. Provisions. If any provision of this Agreement or its application to any person, entity, or property is held invalid, such provision shall be deemed to be excised here from and the invalidity thereof shall not affect the application or validity of any other terms, conditions, and provisions of this Agreement and, to that end, any terms, conditions, and provisions of this Agreement are declared to be severable. 4 IN WITNESS WHEREOF, the parties hereto have caused this Fourth Amendment to be executed by their duly authorized officers on the above date at Yorkville, Illinois. United City of Yorkville, an Illinois municipal corporation By: __________________________________ Mayor Attest: _________________________________ City Clerk Robert M. Loftus By: __________________________________ Owner Ildefonsa Loftus By: __________________________________ Owner